format-version: 1.2
date: 14:07:2011 12:49
saved-by: psi-pi_team
default-namespace: UNIMOD

[Term]
id: UNIMOD:0
name: unimod root node
def: "The root node of the unimod modifications ontology." [UNIMOD:0]

[Term]
id: UNIMOD:1
name: Acetyl
def: "Acetylation." [PMID:14730666, PMID:15350136, RESID:AA0055, URL:http\://www.ionsource.com/Card/acetylation/acetylation.htm, PMID:11999733, RESID:AA0043, RESID:AA0044, RESID:AA0354, RESID:AA0045, RESID:AA0056, RESID:AA0046, RESID:AA0051, RESID:AA0052, RESID:AA0364, RESID:AA0041, RESID:AA0049, RESID:AA0048, RESID:AA0047, PMID:12175151, PMID:11857757, RESID:AA0042, RESID:AA0050, RESID:AA0053, RESID:AA0054, FindMod:ACET, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1]
xref: record_id "1"
xref: delta_mono_mass "42.010565"
xref: delta_avge_mass "42.0367"
xref: delta_composition "H(2) C(2) O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2008-02-15 05:20:02"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Multiple"
xref: spec_1_misc_notes "PT and GIST acetyl light"
xref: spec_2_group "2"
xref: spec_2_hidden "0"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Multiple"
xref: spec_2_misc_notes "GIST acetyl light"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "C"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Post-translational"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "S"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Post-translational"
xref: spec_5_group "5"
xref: spec_5_hidden "0"
xref: spec_5_site "N-term"
xref: spec_5_position "Protein N-term"
xref: spec_5_classification "Post-translational"
xref: spec_6_group "6"
xref: spec_6_hidden "1"
xref: spec_6_site "T"
xref: spec_6_position "Anywhere"
xref: spec_6_classification "Post-translational"
xref: spec_7_group "7"
xref: spec_7_hidden "1"
xref: spec_7_site "Y"
xref: spec_7_position "Anywhere"
xref: spec_7_classification "Chemical derivative"
xref: spec_7_misc_notes "O-acetyl"
xref: spec_8_group "8"
xref: spec_8_hidden "1"
xref: spec_8_site "H"
xref: spec_8_position "Anywhere"
xref: spec_8_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:2
name: Amidated
def: "Amidation." [RESID:AA0088, RESID:AA0087, RESID:AA0086, RESID:AA0085, RESID:AA0084, RESID:AA0083, RESID:AA0082, RESID:AA0081, RESID:AA0089, RESID:AA0090, RESID:AA0091, RESID:AA0092, RESID:AA0093, RESID:AA0094, RESID:AA0095, RESID:AA0096, RESID:AA0097, RESID:AA0098, RESID:AA0099, RESID:AA0100, FindMod:AMID, PMID:14588022, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2]
synonym: "Top-Down sequencing c-type fragment ion" []
xref: record_id "2"
xref: delta_mono_mass "-0.984016"
xref: delta_avge_mass "-0.9848"
xref: delta_composition "H N O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2010-06-28 10:52:25"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "C-term"
xref: spec_1_position "Protein C-term"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "0"
xref: spec_2_site "C-term"
xref: spec_2_position "Any C-term"
xref: spec_2_classification "Artefact"
xref: spec_2_misc_notes "MS/MS experiments of mass spectrometric c-ions (MS^3) can be used for protein identification by library searching. T3-sequencing is such a technique (see reference). Search engines must recognize this as a virtual modification."
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:3
name: Biotin
def: "Biotinylation." [RESID:AA0117, FindMod:BIOT, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=3]
xref: record_id "3"
xref: delta_mono_mass "226.077598"
xref: delta_avge_mass "226.2954"
xref: delta_composition "H(14) C(10) N(2) O(2) S"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-16 15:27:08"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "0"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:4
name: Carbamidomethyl
def: "Iodoacetamide derivative." [PMID:11510821, PMID:12422359, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=4]
synonym: "Carboxyamidomethylation" []
xref: record_id "4"
xref: delta_mono_mass "57.021464"
xref: delta_avge_mass "57.0513"
xref: delta_composition "H(3) C(2) N O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2011-11-21 13:05:07"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Artefact"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N-term"
xref: spec_3_position "Any N-term"
xref: spec_3_classification "Artefact"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "H"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Artefact"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "D"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Artefact"
xref: spec_6_group "6"
xref: spec_6_hidden "1"
xref: spec_6_site "E"
xref: spec_6_position "Anywhere"
xref: spec_6_classification "Artefact"
xref: spec_7_group "7"
xref: spec_7_hidden "1"
xref: spec_7_site "S"
xref: spec_7_position "Anywhere"
xref: spec_7_classification "Artefact"
xref: spec_8_group "8"
xref: spec_8_hidden "1"
xref: spec_8_site "T"
xref: spec_8_position "Anywhere"
xref: spec_8_classification "Artefact"
xref: spec_9_group "9"
xref: spec_9_hidden "1"
xref: spec_9_site "Y"
xref: spec_9_position "Anywhere"
xref: spec_9_classification "Artefact"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:5
name: Carbamyl
def: "Carbamylation." [PMID:12203680, RESID:AA0343, PMID:10978403, RESID:AA0332, URL:http\://www.ionsource.com/Card/carbam/carbam.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=5]
comment: Carbamylation is an irreversible process of non-enzymatic modification of proteins by the breakdown products of urea isocyanic acid reacts with the N-term of a proteine or side chains of lysine and arginine residues.
xref: record_id "5"
xref: delta_mono_mass "43.005814"
xref: delta_avge_mass "43.0247"
xref: delta_composition "H C N O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2011-11-21 13:06:47"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Multiple"
xref: spec_2_group "2"
xref: spec_2_hidden "0"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Multiple"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "R"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Artefact"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "C"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Artefact"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "M"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Artefact"
xref: spec_6_group "6"
xref: spec_6_hidden "1"
xref: spec_6_site "S"
xref: spec_6_position "Anywhere"
xref: spec_6_classification "Chemical derivative"
xref: spec_7_group "7"
xref: spec_7_hidden "1"
xref: spec_7_site "T"
xref: spec_7_position "Anywhere"
xref: spec_7_classification "Chemical derivative"
xref: spec_8_group "8"
xref: spec_8_hidden "1"
xref: spec_8_site "Y"
xref: spec_8_position "Anywhere"
xref: spec_8_classification "Chemical derivative"
xref: spec_9_group "9"
xref: spec_9_hidden "1"
xref: spec_9_site "N-term"
xref: spec_9_position "Protein N-term"
xref: spec_9_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:6
name: Carboxymethyl
def: "Iodoacetic acid derivative." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=6]
synonym: "Carboxymethylation" []
xref: record_id "6"
xref: delta_mono_mass "58.005479"
xref: delta_avge_mass "58.0361"
xref: delta_composition "H(2) C(2) O(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-16 10:21:50"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Artefact"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N-term"
xref: spec_3_position "Any N-term"
xref: spec_3_classification "Artefact"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "W"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Chemical derivative"
xref: spec_4_misc_notes "Hydroxylethanone"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:7
name: Deamidated
def: "Deamidation." [FindMod:FLAC, RESID:AA0128, FindMod:CITR, URL:http\://www.ionsource.com/Card/Deamidation/deamidation.htm, RESID:AA0214, PMID:6838602, PMID:15700232, FindMod:DEAM, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=7]
synonym: "phenyllactyl from N-term Phe Citrullination" []
xref: record_id "7"
xref: delta_mono_mass "0.984016"
xref: delta_avge_mass "0.9848"
xref: delta_composition "H(-1) N(-1) O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2011-05-12 08:53:06"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "Q"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_1_misc_notes "Convertion of glycosylated asparagine residues upon deglycosylation with PNGase F in H2O"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "R"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
xref: spec_2_misc_notes "Protein which is post-translationally modified by the de-imination of one or more arginine residues; Peptidylarginine deiminase (PAD) converts protein bound to citrulline"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "F"
xref: spec_3_position "Protein N-term"
xref: spec_3_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:8
name: ICAT-G
def: "Gygi ICAT(TM) d0." [PMID:10504701, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=8]
xref: record_id "8"
xref: delta_mono_mass "486.251206"
xref: delta_avge_mass "486.6253"
xref: delta_composition "H(38) C(22) N(4) O(6) S"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-16 17:00:43"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:9
name: ICAT-G:2H(8)
def: "Gygi ICAT(TM) d8." [PMID:10504701, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=9]
xref: record_id "9"
xref: delta_mono_mass "494.301420"
xref: delta_avge_mass "494.6746"
xref: delta_composition "H(30) 2H(8) C(22) N(4) O(6) S"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-16 17:01:35"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:10
name: Met->Hse
def: "Homoserine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=10]
comment: Cyanogen bromide (CNBr) cleavage converts the C-term Met to either homoserine or homoserine lactone, depending on pH.
xref: record_id "10"
xref: delta_mono_mass "-29.992806"
xref: delta_avge_mass "-30.0922"
xref: delta_composition "H(-2) C(-1) O S(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-13 15:40:08"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "M"
xref: spec_1_position "Any C-term"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:11
name: Met->Hsl
def: "Homoserine lactone." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=11]
comment: Cyanogen bromide (CNBr) cleavage converts the C-term Met to either homoserine or homoserine lactone, depending on pH.
xref: record_id "11"
xref: delta_mono_mass "-48.003371"
xref: delta_avge_mass "-48.1075"
xref: delta_composition "H(-4) C(-1) S(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-11-14 11:10:15"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "M"
xref: spec_1_position "Any C-term"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:12
name: ICAT-D:2H(8)
def: "Applied Biosystems original ICAT(TM) d8." [URL:http\://www.chemsoc.org/exemplarchem/entries/2002/proteomics/images/icat_reagent.gif, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=12]
xref: record_id "12"
xref: delta_mono_mass "450.275205"
xref: delta_avge_mass "450.6221"
xref: delta_composition "H(26) 2H(8) C(20) N(4) O(5) S"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-16 16:56:23"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:13
name: ICAT-D
def: "Applied Biosystems original ICAT(TM) d0." [URL:http\://www.chemsoc.org/exemplarchem/entries/2002/proteomics/images/icat_reagent.gif, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=13]
xref: record_id "13"
xref: delta_mono_mass "442.224991"
xref: delta_avge_mass "442.5728"
xref: delta_composition "H(34) C(20) N(4) O(5) S"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-16 16:53:48"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:17
name: NIPCAM
def: "N-isopropylcarboxamidomethyl." [PMID:8465942, PMID:11465505, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=17]
synonym: "Dimethylacrylamide, DMA" []
xref: record_id "17"
xref: delta_mono_mass "99.068414"
xref: delta_avge_mass "99.1311"
xref: delta_composition "H(9) C(5) N O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-16 12:39:14"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:20
name: PEO-Iodoacetyl-LC-Biotin
def: "Biotinyl-iodoacetamidyl-3,6-dioxaoctanediamine." [PMID:12038753, PMID:15253424, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=20]
synonym: "Pierce EZ-Link PEO-Iodoacetyl Biotin" []
xref: record_id "20"
xref: delta_mono_mass "414.193691"
xref: delta_avge_mass "414.5196"
xref: delta_composition "H(30) C(18) N(4) O(5) S"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-11-14 11:40:00"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:21
name: Phospho
def: "Phosphorylation." [FindMod:PHOS, RESID:AA0034, RESID:AA0222, RESID:AA0039, RESID:AA0038, RESID:AA0033, RESID:AA0037, URL:http\://www.ionsource.com/Card/phos/phos.htm, RESID:AA0036, RESID:AA0035, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=21]
comment: Protein which is posttranslationally modified by the attachment of at least one phosphate group usually on serine, threonine or tyrosine residues, but also on aspartic acid or histidine residues.
xref: record_id "21"
xref: delta_mono_mass "79.966331"
xref: delta_avge_mass "79.9799"
xref: delta_composition "H O(3) P"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2011-11-25 10:55:54"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "T"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_1_neutral_loss_98_mono_mass "97.976896"
xref: spec_1_neutral_loss_98_avge_mass "97.9952"
xref: spec_1_neutral_loss_98_flag "false"
xref: spec_1_neutral_loss_98_composition "H(3) O(4) P"
xref: spec_1_neutral_loss_0_mono_mass "0.000000"
xref: spec_1_neutral_loss_0_avge_mass "0.0000"
xref: spec_1_neutral_loss_0_flag "false"
xref: spec_1_neutral_loss_0_composition "0"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_1_neutral_loss_0_mono_mass "0.000000"
xref: spec_1_neutral_loss_0_avge_mass "0.0000"
xref: spec_1_neutral_loss_0_flag "false"
xref: spec_1_neutral_loss_0_composition "0"
xref: spec_1_neutral_loss_98_mono_mass "97.976896"
xref: spec_1_neutral_loss_98_avge_mass "97.9952"
xref: spec_1_neutral_loss_98_flag "false"
xref: spec_1_neutral_loss_98_composition "H(3) O(4) P"
xref: spec_2_group "2"
xref: spec_2_hidden "0"
xref: spec_2_site "Y"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
xref: spec_2_misc_notes "Usually don't see beta elimination of phosphate"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "D"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Post-translational"
xref: spec_3_misc_notes "Rare"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "H"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Post-translational"
xref: spec_4_misc_notes "Rare"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "C"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Post-translational"
xref: spec_5_misc_notes "Rare"
xref: spec_6_group "6"
xref: spec_6_hidden "1"
xref: spec_6_site "R"
xref: spec_6_position "Anywhere"
xref: spec_6_classification "Post-translational"
xref: spec_7_group "7"
xref: spec_7_hidden "1"
xref: spec_7_site "K"
xref: spec_7_position "Anywhere"
xref: spec_7_classification "Other"
xref: spec_7_misc_notes "from ProteinPilot"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:23
name: Dehydrated
def: "Dehydration." [FindMod:DHAS, RESID:AA0303, RESID:AA0302, RESID:AA0181, RESID:AA0182, FindMod:DHB, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=23]
synonym: "didehydroalanine C-terminal imide Prompt loss of phosphate from phosphorylated residue D-Succinimide" []
xref: record_id "23"
xref: delta_mono_mass "-18.010565"
xref: delta_avge_mass "-18.0153"
xref: delta_composition "H(-2) O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-11-14 11:05:47"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Protein C-term"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "Q"
xref: spec_2_position "Protein C-term"
xref: spec_2_classification "Post-translational"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "S"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Post-translational"
xref: spec_3_misc_notes "beta-elimination"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "T"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Post-translational"
xref: spec_4_misc_notes "beta-elimination"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "Y"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Post-translational"
xref: spec_5_misc_notes "beta-elimination"
xref: spec_6_group "6"
xref: spec_6_hidden "1"
xref: spec_6_site "D"
xref: spec_6_position "Anywhere"
xref: spec_6_classification "Chemical derivative"
xref: spec_7_group "7"
xref: spec_7_hidden "0"
xref: spec_7_site "C"
xref: spec_7_position "Any N-term"
xref: spec_7_classification "Artefact"
xref: spec_7_misc_notes "Pyro-carboxymethyl as a delta from Carboxymethyl-Cys"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:24
name: Propionamide
def: "Acrylamide adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=24]
xref: record_id "24"
xref: delta_mono_mass "71.037114"
xref: delta_avge_mass "71.0779"
xref: delta_composition "H(5) C(3) N O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2010-12-21 16:57:03"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N-term"
xref: spec_3_position "Any N-term"
xref: spec_3_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:25
name: Pyridylacetyl
def: "Pyridylacetyl." [PMID:9276974, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=25]
xref: record_id "25"
xref: delta_mono_mass "119.037114"
xref: delta_avge_mass "119.1207"
xref: delta_composition "H(5) C(7) N O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-16 12:47:43"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:26
name: Pyro-carbamidomethyl
def: "S-carbamoylmethylcysteine cyclization (N-terminus)." [PMID:12643538, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=26]
comment: Cyclisation of N-term Carbamidomethyl-Cys or Carboxymethyl-Cys. The delta is relative to Cys. For a delta relative to alkylated Cys, see Ammonia-loss and Dehydrated.
synonym: "Carboxymethyl-Cys cyclization (N-terminus) Carbamidomethyl-Cys cyclization (N-terminus)" []
xref: record_id "26"
xref: delta_mono_mass "39.994915"
xref: delta_avge_mass "40.0208"
xref: delta_composition "C(2) O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-11-14 11:05:25"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "C"
xref: spec_1_position "Any N-term"
xref: spec_1_classification "Artefact"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:27
name: Glu->pyro-Glu
def: "Pyro-glu from E." [RESID:AA0031, PMID:8442665, FindMod:PYRE, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=27]
xref: record_id "27"
xref: delta_mono_mass "-18.010565"
xref: delta_avge_mass "-18.0153"
xref: delta_composition "H(-2) O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2008-06-05 13:54:56"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "E"
xref: spec_1_position "Any N-term"
xref: spec_1_classification "Artefact"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:28
name: Gln->pyro-Glu
def: "Pyro-glu from Q." [RESID:AA0031, FindMod:PYRR, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=28]
xref: record_id "28"
xref: delta_mono_mass "-17.026549"
xref: delta_avge_mass "-17.0305"
xref: delta_composition "H(-3) N(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-13 17:06:57"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "Q"
xref: spec_1_position "Any N-term"
xref: spec_1_classification "Artefact"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:29
name: SMA
def: "N-Succinimidyl-2-morpholine acetate." [PMID:10446193, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=29]
xref: record_id "29"
xref: delta_mono_mass "127.063329"
xref: delta_avge_mass "127.1412"
xref: delta_composition "H(9) C(6) N O(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2010-11-03 17:44:14"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:30
name: Cation:Na
def: "Sodium adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=30]
comment: Proton replaced by sodium cation.
xref: record_id "30"
xref: delta_mono_mass "21.981943"
xref: delta_avge_mass "21.9818"
xref: delta_composition "H(-1) Na"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-14 19:43:17"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "C-term"
xref: spec_1_position "Any C-term"
xref: spec_1_classification "Artefact"
xref: spec_2_group "2"
xref: spec_2_hidden "0"
xref: spec_2_site "D"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Artefact"
xref: spec_2_group "2"
xref: spec_2_hidden "0"
xref: spec_2_site "E"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Artefact"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:31
name: Pyridylethyl
def: "S-pyridylethylation." [PMID:11760118, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=31]
xref: record_id "31"
xref: delta_mono_mass "105.057849"
xref: delta_avge_mass "105.1372"
xref: delta_composition "H(7) C(7) N"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-16 12:43:38"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:34
name: Methyl
def: "Methylation." [FindMod:METH, RESID:AA0318, RESID:AA0338, RESID:AA0064, RESID:AA0061, RESID:AA0063, RESID:AA0065, RESID:AA0069, RESID:AA0336, RESID:AA0305, RESID:AA0272, RESID:AA0076, RESID:AA0071, RESID:AA0070, RESID:AA0073, RESID:AA0234, RESID:AA0273, RESID:AA0317, RESID:AA0337, RESID:AA0299, RESID:AA0072, PMID:11875433, RESID:AA0105, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=34]
synonym: "methyl ester" []
xref: record_id "34"
xref: delta_mono_mass "14.015650"
xref: delta_avge_mass "14.0266"
xref: delta_composition "H(2) C"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-14 10:32:35"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "H"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "K"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Post-translational"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "N"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Post-translational"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "N-term"
xref: spec_5_position "Any N-term"
xref: spec_5_classification "Chemical derivative"
xref: spec_6_group "6"
xref: spec_6_hidden "1"
xref: spec_6_site "Q"
xref: spec_6_position "Anywhere"
xref: spec_6_classification "Post-translational"
xref: spec_7_group "7"
xref: spec_7_hidden "1"
xref: spec_7_site "R"
xref: spec_7_position "Anywhere"
xref: spec_7_classification "Post-translational"
xref: spec_8_group "8"
xref: spec_8_hidden "1"
xref: spec_8_site "I"
xref: spec_8_position "Anywhere"
xref: spec_8_classification "Post-translational"
xref: spec_9_group "9"
xref: spec_9_hidden "1"
xref: spec_9_site "L"
xref: spec_9_position "Anywhere"
xref: spec_9_classification "Post-translational"
xref: spec_10_group "10"
xref: spec_10_hidden "1"
xref: spec_10_site "N-term"
xref: spec_10_position "Protein N-term"
xref: spec_10_classification "Post-translational"
xref: spec_11_group "11"
xref: spec_11_hidden "0"
xref: spec_11_site "C-term"
xref: spec_11_position "Any C-term"
xref: spec_11_classification "Multiple"
xref: spec_12_group "12"
xref: spec_12_hidden "0"
xref: spec_12_site "E"
xref: spec_12_position "Anywhere"
xref: spec_12_classification "Post-translational"
xref: spec_12_group "12"
xref: spec_12_hidden "0"
xref: spec_12_site "D"
xref: spec_12_position "Anywhere"
xref: spec_12_classification "Post-translational"
xref: spec_13_group "13"
xref: spec_13_hidden "1"
xref: spec_13_site "S"
xref: spec_13_position "Anywhere"
xref: spec_13_classification "Post-translational"
xref: spec_14_group "14"
xref: spec_14_hidden "1"
xref: spec_14_site "T"
xref: spec_14_position "Anywhere"
xref: spec_14_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:35
name: Oxidation
def: "Oxidation or Hydroxylation." [FindMod:HYDR, RESID:AA0322, PMID:11212008, PMID:11120890, FindMod:DOPA, FindMod:CSEA, PMID:14661084, RESID:AA0026, PMID:15569593, RESID:AA0205, RESID:AA0215, RESID:AA0029, RESID:AA0030, PMID:9004526, RESID:AA0028, PMID:11461766, RESID:AA0027, RESID:AA0235, RESID:AA0146, PMID:14661085, PMID:12781462, PMID:2057999, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=35]
xref: record_id "35"
xref: delta_mono_mass "15.994915"
xref: delta_avge_mass "15.9994"
xref: delta_composition "O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2008-02-15 05:37:07"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "D"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Post-translational"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "P"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Post-translational"
xref: spec_4_misc_notes "Proline oxidation to glutamic semialdehyde"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "F"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Artefact"
xref: spec_6_group "6"
xref: spec_6_hidden "1"
xref: spec_6_site "Y"
xref: spec_6_position "Anywhere"
xref: spec_6_classification "Post-translational"
xref: spec_7_group "7"
xref: spec_7_hidden "1"
xref: spec_7_site "R"
xref: spec_7_position "Anywhere"
xref: spec_7_classification "Post-translational"
xref: spec_8_group "8"
xref: spec_8_hidden "0"
xref: spec_8_site "M"
xref: spec_8_position "Anywhere"
xref: spec_8_classification "Artefact"
xref: spec_8_neutral_loss_0_mono_mass "0.000000"
xref: spec_8_neutral_loss_0_avge_mass "0.0000"
xref: spec_8_neutral_loss_0_flag "false"
xref: spec_8_neutral_loss_0_composition "0"
xref: spec_8_neutral_loss_64_mono_mass "63.998285"
xref: spec_8_neutral_loss_64_avge_mass "64.1069"
xref: spec_8_neutral_loss_64_flag "false"
xref: spec_8_neutral_loss_64_composition "H(4) C O S"
xref: spec_9_group "9"
xref: spec_9_hidden "1"
xref: spec_9_site "C"
xref: spec_9_position "Anywhere"
xref: spec_9_classification "Post-translational"
xref: spec_9_misc_notes "Cysteine sulfenic acid"
xref: spec_10_group "10"
xref: spec_10_hidden "0"
xref: spec_10_site "W"
xref: spec_10_position "Anywhere"
xref: spec_10_classification "Artefact"
xref: spec_10_group "10"
xref: spec_10_hidden "0"
xref: spec_10_site "H"
xref: spec_10_position "Anywhere"
xref: spec_10_classification "Artefact"
xref: spec_11_group "11"
xref: spec_11_hidden "1"
xref: spec_11_site "G"
xref: spec_11_position "Any C-term"
xref: spec_11_classification "Pre-translational"
xref: spec_11_misc_notes "Hydroxyglycine derivative in amidation pathway"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:36
name: Dimethyl
def: "Di-Methylation." [FindMod:DIMETH, RESID:AA0311, RESID:AA0068, PMID:14570711, RESID:AA0067, PMID:12964758, RESID:AA0075, RESID:AA0066, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=36]
xref: record_id "36"
xref: delta_mono_mass "28.031300"
xref: delta_avge_mass "28.0532"
xref: delta_composition "H(4) C(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-18 14:35:31"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "R"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N-term"
xref: spec_3_position "Any N-term"
xref: spec_3_classification "Chemical derivative"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "N"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Post-translational"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "P"
xref: spec_5_position "Protein N-term"
xref: spec_5_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:37
name: Trimethyl
def: "Tri-Methylation." [FindMod:TRIMETH, URL:http\://www.ebi.ac.uk/RESID/faq.html#q12, RESID:AA0062, PMID:12590383, RESID:AA0074, URL:http\://www.cancerci.com/content/1/1/3, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=37]
xref: record_id "37"
xref: delta_mono_mass "42.046950"
xref: delta_avge_mass "42.0797"
xref: delta_composition "H(6) C(3)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2011-02-03 10:02:45"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_1_neutral_loss_60_mono_mass "59.073499"
xref: spec_1_neutral_loss_60_avge_mass "59.1103"
xref: spec_1_neutral_loss_60_flag "false"
xref: spec_1_neutral_loss_60_composition "H(9) C(3) N"
xref: spec_1_neutral_loss_0_mono_mass "0.000000"
xref: spec_1_neutral_loss_0_avge_mass "0.0000"
xref: spec_1_neutral_loss_0_flag "false"
xref: spec_1_neutral_loss_0_composition "0"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "R"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "A"
xref: spec_3_position "Protein N-term"
xref: spec_3_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:39
name: Methylthio
def: "Beta-methylthiolation." [RESID:AA0320, PMID:8844851, URL:http\://www.trc-canada.com/white_papers.lasso, RESID:AA0232, URL:http\://docs.appliedbiosystems.com/pebiodocs/04351918.pdf, RESID:AA0101, FindMod:BMTH, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=39]
synonym: "Methyl methanethiosulfonate MMTS" []
xref: record_id "39"
xref: delta_mono_mass "45.987721"
xref: delta_avge_mass "46.0916"
xref: delta_composition "H(2) C S"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2011-11-24 16:48:21"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "D"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
xref: spec_3_group "3"
xref: spec_3_hidden "0"
xref: spec_3_site "C"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Multiple"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "N-term"
xref: spec_4_position "Any N-term"
xref: spec_4_classification "Artefact"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "K"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Artefact"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:40
name: Sulfo
def: "O-Sulfonation." [RESID:AA0362, RESID:AA0361, FindMod:SULF, RESID:AA0171, PMID:14752058, RESID:AA0172, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=40]
xref: record_id "40"
xref: delta_mono_mass "79.956815"
xref: delta_avge_mass "80.0632"
xref: delta_composition "O(3) S"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-16 11:16:55"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "0"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
xref: spec_3_group "3"
xref: spec_3_hidden "0"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Post-translational"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "C"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Post-translational"
xref: spec_4_misc_notes "Sulfitolysis"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:41
name: Hex
def: "Hexose." [FindMod:CMAN, RESID:AA0217, RESID:AA0327, RESID:AA0157, RESID:AA0152, PMID:15279557, FindMod:GLUC, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=41]
synonym: "Galactose Glucose Fructose Mannose" []
xref: record_id "41"
xref: delta_mono_mass "162.052824"
xref: delta_avge_mass "162.1406"
xref: delta_composition "Hex"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2011-11-21 13:57:35"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other glycosylation"
xref: spec_1_misc_notes "glycation"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "N-linked glycosylation"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N-term"
xref: spec_3_position "Any N-term"
xref: spec_3_classification "Other glycosylation"
xref: spec_3_misc_notes "glycation"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "T"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Other glycosylation"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "W"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Other glycosylation"
xref: spec_6_group "6"
xref: spec_6_hidden "1"
xref: spec_6_site "C"
xref: spec_6_position "Anywhere"
xref: spec_6_classification "Other glycosylation"
xref: spec_7_group "7"
xref: spec_7_hidden "1"
xref: spec_7_site "R"
xref: spec_7_position "Anywhere"
xref: spec_7_classification "Other glycosylation"
xref: spec_8_group "8"
xref: spec_8_hidden "1"
xref: spec_8_site "Y"
xref: spec_8_position "Anywhere"
xref: spec_8_classification "Other glycosylation"
xref: spec_9_group "9"
xref: spec_9_hidden "1"
xref: spec_9_site "S"
xref: spec_9_position "Anywhere"
xref: spec_9_classification "O-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:42
name: Lipoyl
def: "Lipoyl." [RESID:AA0118, FindMod:LIPY, PMID:3522581, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=42]
comment: This group is normally a substituent on N6 of a lysine residue of an enzyme or other protein.
xref: record_id "42"
xref: delta_mono_mass "188.032956"
xref: delta_avge_mass "188.3103"
xref: delta_composition "H(12) C(8) O S(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-16 15:06:53"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:43
name: HexNAc
def: "N-Acetylhexosamine." [FindMod:GLCN, RESID:AA0151, RESID:AA0154, PMID:3086323, RESID:AA0155, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=43]
comment: The amine derivative of a hexose formed by replacing a hydroxyl group with an amino group.(+acetyl group).
xref: record_id "43"
xref: delta_mono_mass "203.079373"
xref: delta_avge_mass "203.1925"
xref: delta_composition "HexNAc"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-16 15:10:27"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "S"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Other glycosylation"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "T"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Other glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:44
name: Farnesyl
def: "Farnesylation." [PMID:15609361, RESID:AA0102, FindMod:FARN, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=44]
xref: record_id "44"
xref: delta_mono_mass "204.187801"
xref: delta_avge_mass "204.3511"
xref: delta_composition "H(24) C(15)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-16 15:11:38"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:45
name: Myristoyl
def: "Myristoylation." [RESID:AA0059, RESID:AA0307, RESID:AA0078, FindMod:MYRI, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=45]
xref: record_id "45"
xref: delta_mono_mass "210.198366"
xref: delta_avge_mass "210.3556"
xref: delta_composition "H(26) C(14) O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-16 15:13:17"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "G"
xref: spec_1_position "Any N-term"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "C"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:46
name: PyridoxalPhosphate
def: "Pyridoxal phosphate." [RESID:AA0119, FindMod:PLP, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=46]
comment: The co-enzyme derivative of vitamin B6. Forms Schiff\'s bases of substrate amino acids during catalysis of transamination, decarboxylation and racemisation reactions.
xref: record_id "46"
xref: delta_mono_mass "229.014009"
xref: delta_avge_mass "229.1266"
xref: delta_composition "H(8) C(8) N O(5) P"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-16 15:35:42"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:47
name: Palmitoyl
def: "Palmitoylation." [RESID:AA0080, RESID:AA0079, RESID:AA0106, RESID:AA0077, FindMod:PALM, RESID:AA0339, RESID:AA0060, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=47]
comment: Palmitoylation is a post-translational modification that consists in the addition of a 16 carbons fatty acid, palmitate, to a cysteine residue through the creation of a thioester link.
xref: record_id "47"
xref: delta_mono_mass "238.229666"
xref: delta_avge_mass "238.4088"
xref: delta_composition "H(30) C(16) O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-16 15:38:43"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "S"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Post-translational"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "T"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Post-translational"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "N-term"
xref: spec_5_position "Protein N-term"
xref: spec_5_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:48
name: GeranylGeranyl
def: "Geranyl-geranyl." [RESID:AA0104, PMID:15609361, FindMod:GERA, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=48]
xref: record_id "48"
xref: delta_mono_mass "272.250401"
xref: delta_avge_mass "272.4681"
xref: delta_composition "H(32) C(20)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-16 15:47:48"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:49
name: Phosphopantetheine
def: "Phosphopantetheine." [RESID:AA0150, FindMod:PPAN, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=49]
comment: Protein which contains at least one phosphopantetheine as the prosthetic group. In acyl carrier proteins (ACP) for example, it serves as a \'swinging arm\' for the attachment of activated fatty acid and amino-acid groups.
xref: record_id "49"
xref: delta_mono_mass "340.085794"
xref: delta_avge_mass "340.3330"
xref: delta_composition "H(21) C(11) N(2) O(6) P S"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-16 16:00:24"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:50
name: FAD
def: "Flavin adenine dinucleotide." [RESID:AA0143, URL:http\://www.aw-bc.com/mathews/EF/FAD.GIF, RESID:AA0144, RESID:AA0145, RESID:AA0221, FindMod:FAD, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=50]
xref: record_id "50"
xref: delta_mono_mass "783.141486"
xref: delta_avge_mass "783.5339"
xref: delta_composition "H(31) C(27) N(9) O(15) P(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-16 17:16:18"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "H"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:51
name: Tripalmitate
def: "N-acyl diglyceride cysteine." [PMID:10356335, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=51]
xref: record_id "51"
xref: delta_mono_mass "788.725777"
xref: delta_avge_mass "789.3049"
xref: delta_composition "H(96) C(51) O(5)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-10-18 11:47:54"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Protein N-term"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:52
name: Guanidinyl
def: "Guanidination." [PMID:11821862, URL:http\://www.indiana.edu/~reillyjp/ASMS2001posters/beardsley_poster.pdf, PMID:11078590, PMID:11085420, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=52]
comment: Specific for sidechain of lysine. Does not modify the N-termini except for glycine at a slower rate than the side chain of lysine.
synonym: "homoarginine" []
xref: record_id "52"
xref: delta_mono_mass "42.021798"
xref: delta_avge_mass "42.0400"
xref: delta_composition "H(2) C N(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2011-11-21 13:56:40"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:53
name: HNE
def: "4-hydroxynonenal (HNE)." [PMID:11327326, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=53]
comment: A lipid-type modification. HNE forms a Michael addition product on Cysteine, Histidine and Lysines. Unusually, it doesn\'t replace a hydrogen on the amino acid side chain.
xref: record_id "53"
xref: delta_mono_mass "156.115030"
xref: delta_avge_mass "156.2221"
xref: delta_composition "H(16) C(9) O(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-08-19 19:17:11"
xref: date_time_modified "2006-11-14 11:38:12"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "H"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:54
name: Glucuronyl
def: "N-glucuronylation." [RESID:AA0291, RESID:AA0058, PMID:7398618, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=54]
comment: The addition of a sugar unit to a protein amino acid, e.g. the addition of glycan chains to proteins. Addition of glucuronic acid. Observed for N-term G.
synonym: "glucuronosyl" []
xref: record_id "54"
xref: delta_mono_mass "176.032088"
xref: delta_avge_mass "176.1241"
xref: delta_composition "H(8) C(6) O(6)"
xref: username_of_poster "jcottrell"
xref: group_of_poster "users"
xref: date_time_posted "2002-10-01 21:36:48"
xref: date_time_modified "2006-10-16 17:26:21"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N-term"
xref: spec_1_position "Protein N-term"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "S"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:55
name: Glutathione
def: "Glutathione disulfide." [PMID:3083866, PMID:8344916, RESID:AA0229, FindMod:GLUT, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=55]
xref: record_id "55"
xref: delta_mono_mass "305.068156"
xref: delta_avge_mass "305.3076"
xref: delta_composition "H(15) C(10) N(3) O(6) S"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2002-10-03 09:10:19"
xref: date_time_modified "2006-10-16 15:51:52"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:56
name: Acetyl:2H(3)
def: "Acetate labeling reagent (N-term & K) (heavy form, +3amu)." [PMID:11857757, PMID:11999733, PMID:12175151, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=56]
synonym: "N-trideuteriumacetoxy" []
xref: record_id "56"
xref: delta_mono_mass "45.029395"
xref: delta_avge_mass "45.0552"
xref: delta_composition "H(-1) 2H(3) C(2) O"
xref: username_of_poster "penner"
xref: group_of_poster "users"
xref: date_time_posted "2002-10-16 16:41:56"
xref: date_time_modified "2011-11-21 10:07:03"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "H"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Isotopic label"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "S"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Isotopic label"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "T"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Isotopic label"
xref: spec_6_group "6"
xref: spec_6_hidden "1"
xref: spec_6_site "Y"
xref: spec_6_position "Anywhere"
xref: spec_6_classification "Isotopic label"
xref: spec_7_group "7"
xref: spec_7_hidden "1"
xref: spec_7_site "N-term"
xref: spec_7_position "Protein N-term"
xref: spec_7_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:58
name: Propionyl
def: "Propionate labeling reagent light form (N-term & K)." [PMID:12175151, PMID:11999733, PMID:11857757, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=58]
xref: record_id "58"
xref: delta_mono_mass "56.026215"
xref: delta_avge_mass "56.0633"
xref: delta_composition "H(4) C(3) O"
xref: username_of_poster "penner"
xref: group_of_poster "users"
xref: date_time_posted "2002-10-16 16:52:38"
xref: date_time_modified "2011-11-25 11:01:23"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "S"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "T"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Isotopic label"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "N-term"
xref: spec_5_position "Protein N-term"
xref: spec_5_classification "Multiple"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:59
name: Propionyl:13C(3)
def: "Propionate labeling reagent heavy form (+3amu), N-term & K." [PMID:11857757, PMID:12175151, PMID:11999733, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=59]
xref: record_id "59"
xref: delta_mono_mass "59.036279"
xref: delta_avge_mass "59.0412"
xref: delta_composition "H(4) 13C(3) O"
xref: username_of_poster "penner"
xref: group_of_poster "users"
xref: date_time_posted "2002-10-16 16:55:47"
xref: date_time_modified "2006-10-16 10:27:21"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:60
name: GIST-Quat
def: "Quaternary amine labeling reagent light form (N-term & K)." [PMID:11857757, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=60]
synonym: "N-(4-trimethylammoniumbutanoxy)-NHS" []
xref: record_id "60"
xref: delta_mono_mass "127.099714"
xref: delta_avge_mass "127.1842"
xref: delta_composition "H(13) C(7) N O"
xref: username_of_poster "penner"
xref: group_of_poster "users"
xref: date_time_posted "2002-10-16 17:02:37"
xref: date_time_modified "2006-10-16 13:39:27"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_1_neutral_loss_60_mono_mass "59.073499"
xref: spec_1_neutral_loss_60_avge_mass "59.1103"
xref: spec_1_neutral_loss_60_flag "false"
xref: spec_1_neutral_loss_60_composition "H(9) C(3) N"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_2_neutral_loss_60_mono_mass "59.073499"
xref: spec_2_neutral_loss_60_avge_mass "59.1103"
xref: spec_2_neutral_loss_60_flag "false"
xref: spec_2_neutral_loss_60_composition "H(9) C(3) N"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:61
name: GIST-Quat:2H(3)
def: "Quaternary amine labeling reagent heavy (+3amu) form, N-term & K." [PMID:11857757, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=61]
xref: record_id "61"
xref: delta_mono_mass "130.118544"
xref: delta_avge_mass "130.2027"
xref: delta_composition "H(10) 2H(3) C(7) N O"
xref: username_of_poster "penner"
xref: group_of_poster "users"
xref: date_time_posted "2002-10-16 17:09:34"
xref: date_time_modified "2006-10-16 13:40:03"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_1_neutral_loss_63_mono_mass "62.092330"
xref: spec_1_neutral_loss_63_avge_mass "62.1287"
xref: spec_1_neutral_loss_63_flag "false"
xref: spec_1_neutral_loss_63_composition "H(6) 2H(3) C(3) N"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_2_neutral_loss_63_mono_mass "62.092330"
xref: spec_2_neutral_loss_63_avge_mass "62.1287"
xref: spec_2_neutral_loss_63_flag "false"
xref: spec_2_neutral_loss_63_composition "H(6) 2H(3) C(3) N"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:62
name: GIST-Quat:2H(6)
def: "Quaternary amine labeling reagent heavy form (+6amu), N-term & K." [PMID:11857757, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=62]
xref: record_id "62"
xref: delta_mono_mass "133.137375"
xref: delta_avge_mass "133.2212"
xref: delta_composition "H(7) 2H(6) C(7) N O"
xref: username_of_poster "penner"
xref: group_of_poster "users"
xref: date_time_posted "2002-10-16 17:12:27"
xref: date_time_modified "2006-10-16 13:40:56"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_1_neutral_loss_66_mono_mass "65.111160"
xref: spec_1_neutral_loss_66_avge_mass "65.1472"
xref: spec_1_neutral_loss_66_flag "false"
xref: spec_1_neutral_loss_66_composition "H(3) 2H(6) C(3) N"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_2_neutral_loss_66_mono_mass "65.111160"
xref: spec_2_neutral_loss_66_avge_mass "65.1472"
xref: spec_2_neutral_loss_66_flag "false"
xref: spec_2_neutral_loss_66_composition "H(3) 2H(6) C(3) N"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:63
name: GIST-Quat:2H(9)
def: "Quaternary amine labeling reagent heavy form (+9amu), N-term & K." [PMID:11857757, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=63]
xref: record_id "63"
xref: delta_mono_mass "136.156205"
xref: delta_avge_mass "136.2397"
xref: delta_composition "H(4) 2H(9) C(7) N O"
xref: username_of_poster "penner"
xref: group_of_poster "users"
xref: date_time_posted "2002-10-16 17:14:22"
xref: date_time_modified "2006-10-16 13:41:45"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_1_neutral_loss_69_mono_mass "68.129990"
xref: spec_1_neutral_loss_69_avge_mass "68.1657"
xref: spec_1_neutral_loss_69_flag "false"
xref: spec_1_neutral_loss_69_composition "2H(9) C(3) N"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_2_neutral_loss_69_mono_mass "68.129990"
xref: spec_2_neutral_loss_69_avge_mass "68.1657"
xref: spec_2_neutral_loss_69_flag "false"
xref: spec_2_neutral_loss_69_composition "2H(9) C(3) N"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:64
name: Succinyl
def: "Succinic anhydride labeling reagent light form (N-term & K)." [PMID:12175151, PMID:11857757, RESID:AA0130, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=64]
xref: record_id "64"
xref: delta_mono_mass "100.016044"
xref: delta_avge_mass "100.0728"
xref: delta_composition "H(4) C(4) O(3)"
xref: username_of_poster "penner"
xref: group_of_poster "users"
xref: date_time_posted "2002-10-16 17:17:07"
xref: date_time_modified "2006-10-16 12:40:39"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N-term"
xref: spec_3_position "Protein N-term"
xref: spec_3_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:65
name: Succinyl:2H(4)
def: "Succinic anhydride labeling reagent, heavy form (+4amu, 4H2), N-term & K." [PMID:11857757, PMID:12175151, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=65]
xref: record_id "65"
xref: delta_mono_mass "104.041151"
xref: delta_avge_mass "104.0974"
xref: delta_composition "2H(4) C(4) O(3)"
xref: username_of_poster "penner"
xref: group_of_poster "users"
xref: date_time_posted "2002-10-16 17:19:51"
xref: date_time_modified "2006-10-16 12:42:10"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:66
name: Succinyl:13C(4)
def: "Succinic anhydride labeling reagent, heavy form (+4amu, 4C13), N-term & K." [PMID:11857757, PMID:12175151, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=66]
xref: record_id "66"
xref: delta_mono_mass "104.029463"
xref: delta_avge_mass "104.0434"
xref: delta_composition "H(4) 13C(4) O(3)"
xref: username_of_poster "penner"
xref: group_of_poster "users"
xref: date_time_posted "2002-10-16 17:23:58"
xref: date_time_modified "2006-10-16 12:41:49"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:89
name: Iminobiotin
def: "Iminobiotinylation." [PMID:9750125, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=89]
xref: record_id "89"
xref: delta_mono_mass "225.093583"
xref: delta_avge_mass "225.3106"
xref: delta_composition "H(15) C(10) N(3) O S"
xref: username_of_poster "toppolzer"
xref: group_of_poster "users"
xref: date_time_posted "2002-11-25 16:01:48"
xref: date_time_modified "2006-10-16 15:26:37"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:90
name: ESP
def: "ESP-Tag light d0." [URL:http\://www.wzw.tum.de/proteomik/forum2003/Posters-Abstracts.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=90]
xref: record_id "90"
xref: delta_mono_mass "338.177647"
xref: delta_avge_mass "338.4682"
xref: delta_composition "H(26) C(16) N(4) O(2) S"
xref: username_of_poster "toppolzer"
xref: group_of_poster "users"
xref: date_time_posted "2002-11-25 16:12:50"
xref: date_time_modified "2006-10-16 15:58:19"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:91
name: ESP:2H(10)
def: "ESP-Tag heavy d10." [URL:http\://www.wzw.tum.de/proteomik/forum2003/Posters-Abstracts.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=91]
xref: record_id "91"
xref: delta_mono_mass "348.240414"
xref: delta_avge_mass "348.5299"
xref: delta_composition "H(16) 2H(10) C(16) N(4) O(2) S"
xref: username_of_poster "toppolzer"
xref: group_of_poster "users"
xref: date_time_posted "2002-11-25 16:18:58"
xref: date_time_modified "2006-10-16 16:03:06"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:92
name: NHS-LC-Biotin
def: "NHS-LC-Biotin." [URL:http\://www.piercenet.com/Proteomics/browse.cfm?fldID=84EBE112-F871-4CA5-807F-47327153CFCB, URL:http\://www.piercenet.com/Products/Browse.cfm?fldID=8D38BA83-EFDC-421A-853F-E96EBA380612, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=92]
xref: record_id "92"
xref: delta_mono_mass "339.161662"
xref: delta_avge_mass "339.4530"
xref: delta_composition "H(25) C(16) N(3) O(3) S"
xref: username_of_poster "toppolzer"
xref: group_of_poster "users"
xref: date_time_posted "2002-12-04 09:55:19"
xref: date_time_modified "2006-11-14 11:14:57"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:93
name: EDT-maleimide-PEO-biotin
def: "EDT-maleimide-PEO-biotin." [URL:http\://www.piercenet.com/Products/Browse.cfm?fldID=01031005, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=93]
xref: record_id "93"
xref: delta_mono_mass "601.206246"
xref: delta_avge_mass "601.8021"
xref: delta_composition "H(39) C(25) N(5) O(6) S(3)"
xref: username_of_poster "take"
xref: group_of_poster "users"
xref: date_time_posted "2002-12-27 09:08:56"
xref: date_time_modified "2006-11-14 11:15:06"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:94
name: IMID
def: "IMID d0." [PMID:11746907, URL:http\://www.chem.agilent.com/cag/lystag.asp, URL:http\://www.chem.agilent.com/cag/other/IMTHUPO2003.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=94]
synonym: "2-methoxy-4,5-dihydro-1H-imidazole derivative Lys imidazole" []
xref: record_id "94"
xref: delta_mono_mass "68.037448"
xref: delta_avge_mass "68.0773"
xref: delta_composition "H(4) C(3) N(2)"
xref: username_of_poster "Liao"
xref: group_of_poster "users"
xref: date_time_posted "2003-01-09 04:14:06"
xref: date_time_modified "2006-10-16 10:33:45"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:95
name: IMID:2H(4)
def: "IMID d4." [URL:http\://www.chem.agilent.com/cag/lystag.asp, PMID:11746907, URL:http\://www.chem.agilent.com/cag/other/IMTHUPO2003.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=95]
synonym: "2-methoxy-4,5-dihydro-1H-imidazole derivative" []
xref: record_id "95"
xref: delta_mono_mass "72.062555"
xref: delta_avge_mass "72.1019"
xref: delta_composition "2H(4) C(3) N(2)"
xref: username_of_poster "Liao"
xref: group_of_poster "users"
xref: date_time_posted "2003-01-09 04:15:25"
xref: date_time_modified "2006-10-16 11:06:13"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:97
name: Propionamide:2H(3)
def: "Acrylamide d3." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=97]
xref: record_id "97"
xref: delta_mono_mass "74.055944"
xref: delta_avge_mass "74.0964"
xref: delta_composition "H(2) 2H(3) C(3) N O"
xref: username_of_poster "Liao"
xref: group_of_poster "users"
xref: date_time_posted "2003-01-14 08:10:30"
xref: date_time_modified "2006-10-16 11:07:07"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:105
name: ICAT-C
def: "Applied Biosystems cleavable ICAT(TM) light." [URL:http\://www.chemsoc.org/exemplarchem/entries/2002/proteomics/icat.htm, URL:https\://products.appliedbiosystems.com/ab/en/US/adirect/ab?cmd=catNavigate2&catID=600902, URL:http\://docs.appliedbiosystems.com/pebiodocs/04333373.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=105]
xref: record_id "105"
xref: delta_mono_mass "227.126991"
xref: delta_avge_mass "227.2603"
xref: delta_composition "H(17) C(10) N(3) O(3)"
xref: username_of_poster "tpjd2"
xref: group_of_poster "users"
xref: date_time_posted "2003-01-27 10:27:11"
xref: date_time_modified "2006-10-16 15:32:17"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:106
name: ICAT-C:13C(9)
def: "Applied Biosystems cleavable ICAT(TM) heavy." [URL:http\://docs.appliedbiosystems.com/pebiodocs/04333373.pdf, URL:https\://products.appliedbiosystems.com/ab/en/US/adirect/ab?cmd=catNavigate2&catID=600902, URL:http\://www.chemsoc.org/exemplarchem/entries/2002/proteomics/icat.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=106]
xref: record_id "106"
xref: delta_mono_mass "236.157185"
xref: delta_avge_mass "236.1942"
xref: delta_composition "H(17) C 13C(9) N(3) O(3)"
xref: username_of_poster "tpjd2"
xref: group_of_poster "users"
xref: date_time_posted "2003-01-27 10:32:53"
xref: date_time_modified "2006-10-16 15:34:14"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:107
name: FormylMet
def: "Addition of N-formyl met." [RESID:AA0021, PMID:10825024, PMID:8758896, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=107]
xref: record_id "107"
xref: delta_mono_mass "159.035399"
xref: delta_avge_mass "159.2062"
xref: delta_composition "H(9) C(6) N O(2) S"
xref: username_of_poster "jphilip"
xref: group_of_poster "users"
xref: date_time_posted "2003-01-27 18:24:14"
xref: date_time_modified "2006-10-16 14:08:15"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N-term"
xref: spec_1_position "Protein N-term"
xref: spec_1_classification "Pre-translational"
xref: spec_1_misc_notes "only with Listeria monocytogenes (gram-positive bacteria)"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:108
name: Nethylmaleimide
def: "N-ethylmaleimide on cysteines." [URL:http\://www.chemistry.ucsc.edu/~fink/231/Image118.gif, PMID:12777388, PMID:11813307, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=108]
synonym: "CysNEM" []
xref: record_id "108"
xref: delta_mono_mass "125.047679"
xref: delta_avge_mass "125.1253"
xref: delta_composition "H(7) C(6) N O(2)"
xref: username_of_poster "Pflieger"
xref: group_of_poster "users"
xref: date_time_posted "2003-01-30 09:52:51"
xref: date_time_modified "2006-10-16 13:36:10"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:112
name: OxLysBiotinRed
def: "Oxidized lysine biotinylated with biotin-LC-hydrazide, reduced." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=112]
xref: record_id "112"
xref: delta_mono_mass "354.172562"
xref: delta_avge_mass "354.4676"
xref: delta_composition "H(26) C(16) N(4) O(3) S"
xref: username_of_poster "S_Lee"
xref: group_of_poster "users"
xref: date_time_posted "2003-02-21 00:53:43"
xref: date_time_modified "2006-11-14 12:10:49"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:113
name: OxLysBiotin
def: "Oxidized lysine biotinylated with biotin-LC-hydrazide." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=113]
xref: record_id "113"
xref: delta_mono_mass "352.156911"
xref: delta_avge_mass "352.4518"
xref: delta_composition "H(24) C(16) N(4) O(3) S"
xref: username_of_poster "S_Lee"
xref: group_of_poster "users"
xref: date_time_posted "2003-02-21 01:25:11"
xref: date_time_modified "2006-11-14 12:10:53"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:114
name: OxProBiotinRed
def: "Oxidized proline biotinylated with biotin-LC-hydrazide, reduced." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=114]
xref: record_id "114"
xref: delta_mono_mass "371.199111"
xref: delta_avge_mass "371.4982"
xref: delta_composition "H(29) C(16) N(5) O(3) S"
xref: username_of_poster "S_Lee"
xref: group_of_poster "users"
xref: date_time_posted "2003-02-21 01:34:28"
xref: date_time_modified "2006-11-14 12:11:11"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "P"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:115
name: OxProBiotin
def: "Oxidized Proline biotinylated with biotin-LC-hydrazide." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=115]
xref: record_id "115"
xref: delta_mono_mass "369.183461"
xref: delta_avge_mass "369.4823"
xref: delta_composition "H(27) C(16) N(5) O(3) S"
xref: username_of_poster "S_Lee"
xref: group_of_poster "users"
xref: date_time_posted "2003-02-21 01:35:44"
xref: date_time_modified "2006-11-14 12:11:17"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "P"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:116
name: OxArgBiotin
def: "Oxidized arginine biotinylated with biotin-LC-hydrazide." [URL:http\://www.piercenet.com/Proteomics/browse.cfm?fldID=84EBE112-F871-4CA5-807F-47327153CFCB, URL:http\://themedicalbiochemistrypage.org/nitrogen-metabolism.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=116]
xref: record_id "116"
xref: delta_mono_mass "310.135113"
xref: delta_avge_mass "310.4118"
xref: delta_composition "H(22) C(15) N(2) O(3) S"
xref: username_of_poster "S_Lee"
xref: group_of_poster "users"
xref: date_time_posted "2003-02-21 01:41:19"
xref: date_time_modified "2011-07-18 11:34:02"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:117
name: OxArgBiotinRed
def: "Oxidized arginine biotinylated with biotin-LC-hydrazide, reduced." [URL:http\://www.piercenet.com/Proteomics/browse.cfm?fldID=84EBE112-F871-4CA5-807F-47327153CFCB, URL:http\://themedicalbiochemistrypage.org/nitrogen-metabolism.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=117]
xref: record_id "117"
xref: delta_mono_mass "312.150763"
xref: delta_avge_mass "312.4277"
xref: delta_composition "H(24) C(15) N(2) O(3) S"
xref: username_of_poster "S_Lee"
xref: group_of_poster "users"
xref: date_time_posted "2003-02-21 01:43:00"
xref: date_time_modified "2011-07-18 11:33:41"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:118
name: EDT-iodoacetyl-PEO-biotin
def: "EDT-iodo-PEO-biotin." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=118]
xref: record_id "118"
xref: delta_mono_mass "490.174218"
xref: delta_avge_mass "490.7034"
xref: delta_composition "H(34) C(20) N(4) O(4) S(3)"
xref: username_of_poster "take"
xref: group_of_poster "users"
xref: date_time_posted "2003-02-24 07:18:42"
xref: date_time_modified "2006-10-16 17:01:15"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:119
name: IBTP
def: "Thio Ether Formation - BTP Adduct." [PMID:11861642, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=119]
xref: record_id "119"
xref: delta_mono_mass "316.138088"
xref: delta_avge_mass "316.3759"
xref: delta_composition "H(21) C(22) P"
xref: username_of_poster "MRCDunn"
xref: group_of_poster "users"
xref: date_time_posted "2003-03-13 09:36:40"
xref: date_time_modified "2006-10-16 15:52:42"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:121
name: GlyGly
def: "Ubiquitinylation residue." [PMID:12872131, URL:http\://www.nottingham.ac.uk/biochemcourses/students/ub/ubindex.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=121]
comment: The two glycine residues left on ubiquitinylated lysine after tryptic digestion.
synonym: "glycineglycine" []
xref: record_id "121"
xref: delta_mono_mass "114.042927"
xref: delta_avge_mass "114.1026"
xref: delta_composition "H(6) C(4) N(2) O(2)"
xref: username_of_poster "gielbert"
xref: group_of_poster "users"
xref: date_time_posted "2003-04-30 13:32:37"
xref: date_time_modified "2008-04-21 18:24:57"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "S"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Other"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "T"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Other"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "C"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Other"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:122
name: Formyl
def: "Formylation." [RESID:AA0211, PMID:15799070, RESID:AA0021, FindMod:FORM, RESID:AA0384, RESID:AA0057, RESID:AA0384, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=122]
xref: record_id "122"
xref: delta_mono_mass "27.994915"
xref: delta_avge_mass "28.0101"
xref: delta_composition "C O"
xref: username_of_poster "pnacman"
xref: group_of_poster "users"
xref: date_time_posted "2003-05-01 13:28:36"
xref: date_time_modified "2006-11-14 12:01:57"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_1_misc_notes "Can occur under CNBr cleavage conditions (70% HCOOH)"
xref: spec_2_group "2"
xref: spec_2_hidden "0"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Artefact"
xref: spec_2_misc_notes "Can occur under CNBr cleavage conditions (70% HCOOH)"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "S"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Artefact"
xref: spec_3_misc_notes "Can occur under CNBr cleavage conditions (70% HCOOH)"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "T"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Artefact"
xref: spec_4_misc_notes "Can occur under CNBr cleavage conditions (70% HCOOH)"
xref: spec_5_group "5"
xref: spec_5_hidden "0"
xref: spec_5_site "N-term"
xref: spec_5_position "Protein N-term"
xref: spec_5_classification "Post-translational"
xref: spec_5_misc_notes "A protein in which either the N-terminal N-formylmethionine has not been processed by the methionyl-tRNA formyltransferase or which is posttranslationally modified by the attachment of at least one formyl group."
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:123
name: ICAT-H
def: "N-iodoacetyl, p-chlorobenzyl-12C6-glucamine." [PMID:12185208, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=123]
synonym: "Harbury glyco-ICAT C12" []
xref: record_id "123"
xref: delta_mono_mass "345.097915"
xref: delta_avge_mass "345.7754"
xref: delta_composition "H(20) C(15) N O(6) Cl"
xref: username_of_poster "allis"
xref: group_of_poster "users"
xref: date_time_posted "2003-05-07 19:54:20"
xref: date_time_modified "2006-10-16 16:02:00"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:124
name: ICAT-H:13C(6)
def: "N-iodoacetyl, p-chlorobenzyl-13C6-glucamine." [PMID:12185208, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=124]
synonym: "Harbury glyco-ICAT C13" []
xref: record_id "124"
xref: delta_mono_mass "351.118044"
xref: delta_avge_mass "351.7313"
xref: delta_composition "H(20) C(9) 13C(6) N O(6) Cl"
xref: username_of_poster "allis"
xref: group_of_poster "users"
xref: date_time_posted "2003-05-07 19:56:12"
xref: date_time_modified "2006-10-16 16:04:02"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:126
name: Thioacyl
def: "3-sulfanylpropanoyl." [PMID:3155470, PMID:957432, URL:http\://www.piercenet.com/products/browse.cfm?fldID=01030908, PMID:11710128, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=126]
comment: Reduced product of reaction with 3,3-Dithio-bis-(sulfosuccinimidyl)propionate. Note that name thioacyl is misleading and subject to change in a future revision. Can also be the product of reaction with EZ-Link Sulfo-NHS-SS-Biotin (Sulfosuccinimidyl 2-(biotinamido)-ethyl-1, 3-dithiopropionate) followed by reduction with DTT.
xref: record_id "126"
xref: delta_mono_mass "87.998285"
xref: delta_avge_mass "88.1283"
xref: delta_composition "H(4) C(3) O S"
xref: username_of_poster "rabah"
xref: group_of_poster "users"
xref: date_time_posted "2003-06-05 13:38:19"
xref: date_time_modified "2010-08-17 16:42:36"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Other"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:127
name: Fluoro
def: "Fluorophenylalanine replacement of phenylalanine." [PMID:1093385, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=127]
xref: record_id "127"
xref: delta_mono_mass "17.990578"
xref: delta_avge_mass "17.9905"
xref: delta_composition "H(-1) F"
xref: username_of_poster "jschulte"
xref: group_of_poster "users"
xref: date_time_posted "2003-06-19 19:54:25"
xref: date_time_modified "2007-07-08 18:42:53"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "F"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Non-standard residue"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "W"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Non-standard residue"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Non-standard residue"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:128
name: Fluorescein
def: "5-Iodoacetamidofluorescein (Molecular Probe, Eugene, OR)." [PMID:3578767, PMID:3311742, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=128]
xref: record_id "128"
xref: delta_mono_mass "388.082112"
xref: delta_avge_mass "388.3497"
xref: delta_composition "H(14) C(22) N O(6)"
xref: username_of_poster "Philip"
xref: group_of_poster "users"
xref: date_time_posted "2003-06-25 02:58:18"
xref: date_time_modified "2006-10-16 16:42:41"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:129
name: Iodo
def: "Iodination." [PMID:2026710, PMID:15627961, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=129]
xref: record_id "129"
xref: delta_mono_mass "125.896648"
xref: delta_avge_mass "125.8965"
xref: delta_composition "H(-1) I"
xref: username_of_poster "brettsp"
xref: group_of_poster "users"
xref: date_time_posted "2003-07-10 15:43:17"
xref: date_time_modified "2006-10-16 13:38:03"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Y"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "H"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:130
name: Diiodo
def: "Di-Iodination." [PMID:15627961, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=130]
xref: record_id "130"
xref: delta_mono_mass "251.793296"
xref: delta_avge_mass "251.7931"
xref: delta_composition "H(-2) I(2)"
xref: username_of_poster "brettsp"
xref: group_of_poster "users"
xref: date_time_posted "2003-07-10 15:49:42"
xref: date_time_modified "2011-11-21 13:23:20"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Y"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "H"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:131
name: Triiodo
def: "Tri-Iodination." [PMID:2026710, PMID:15627961, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=131]
xref: record_id "131"
xref: delta_mono_mass "377.689944"
xref: delta_avge_mass "377.6896"
xref: delta_composition "H(-3) I(3)"
xref: username_of_poster "brettsp"
xref: group_of_poster "users"
xref: date_time_posted "2003-07-10 15:51:32"
xref: date_time_modified "2006-10-16 16:36:49"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Y"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:134
name: Myristoleyl
def: "(cis-delta 5)-tetradecaenoyl." [PMID:1326520, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=134]
comment: Found on vision signal transduction proteins.
synonym: "myristoyl with one double bond C14:1 acylation" []
xref: record_id "134"
xref: delta_mono_mass "208.182715"
xref: delta_avge_mass "208.3398"
xref: delta_composition "H(24) C(14) O"
xref: username_of_poster "tomneubert"
xref: group_of_poster "users"
xref: date_time_posted "2003-07-18 21:30:51"
xref: date_time_modified "2006-10-16 15:11:18"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "G"
xref: spec_1_position "Protein N-term"
xref: spec_1_classification "Co-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:135
name: Myristoyl+Delta:H(-4)
def: "(cis,cis-delta 5, delta 8)-tetradecadienoyl." [PMID:1326520, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=135]
comment: Found on vision signal transduction proteins.
synonym: "myristoyl with 2 double bonds C14:2 fatty acylation" []
xref: record_id "135"
xref: delta_mono_mass "206.167065"
xref: delta_avge_mass "206.3239"
xref: delta_composition "H(22) C(14) O"
xref: username_of_poster "tomneubert"
xref: group_of_poster "users"
xref: date_time_posted "2003-07-18 21:36:44"
xref: date_time_modified "2006-10-16 15:10:51"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "G"
xref: spec_1_position "Protein N-term"
xref: spec_1_classification "Co-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:136
name: Benzoyl
def: "Labeling reagent light form (N-term & K)." [PMID:15456300, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=136]
xref: record_id "136"
xref: delta_mono_mass "104.026215"
xref: delta_avge_mass "104.1061"
xref: delta_composition "H(4) C(7) O"
xref: username_of_poster "samirjulka"
xref: group_of_poster "users"
xref: date_time_posted "2003-07-31 22:24:05"
xref: date_time_modified "2006-10-16 12:41:22"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:137
name: Hex(5)HexNAc(2)
def: "N-linked glycan core." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=137]
comment: Core structure of high-mannose N-linked oligosaccharides.
synonym: "Man5" []
xref: record_id "137"
xref: delta_mono_mass "1216.422863"
xref: delta_avge_mass "1217.0880"
xref: delta_composition "Hex(5) HexNAc(2)"
xref: username_of_poster "tpjd2"
xref: group_of_poster "users"
xref: date_time_posted "2003-08-06 11:31:37"
xref: date_time_modified "2006-10-16 17:22:04"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:139
name: Dansyl
def: "5-dimethylaminonaphthalene-1-sulfonyl." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=139]
xref: record_id "139"
xref: delta_mono_mass "233.051049"
xref: delta_avge_mass "233.2862"
xref: delta_composition "H(11) C(12) N O(2) S"
xref: username_of_poster "allis"
xref: group_of_poster "users"
xref: date_time_posted "2003-08-19 02:51:24"
xref: date_time_modified "2006-10-16 15:36:09"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:140
name: a-type-ion
def: "ISD a-series (C-Term)." [PMID:14588022, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=140]
comment: MS/MS experiments of mass spectrometric a-ions (MS^3) can be used for protein identification by library searching. T3-sequencing is such a technique (see reference). Search engines must recognize this \'virtual modification\' for this purpose.
synonym: "Decarboxylation of C-terminus as reaction inside the mass spectrometer" []
xref: record_id "140"
xref: delta_mono_mass "-46.005479"
xref: delta_avge_mass "-46.0254"
xref: delta_composition "H(-2) C(-1) O(-2)"
xref: username_of_poster "suckau"
xref: group_of_poster "users"
xref: date_time_posted "2003-09-02 16:17:09"
xref: date_time_modified "2010-06-08 14:19:03"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C-term"
xref: spec_1_position "Any C-term"
xref: spec_1_classification "Other"
xref: spec_1_misc_notes "Virtual Modification for MS/MS of a-type ions corrected by subtraction of a further -O at 8.6.2010"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:141
name: Amidine
def: "Amidination of lysines or N-terminal amines with methyl acetimidate." [URL:http\://www.indiana.edu/~reillyjp/ASMS2004/janecki_Ext-Abs%20Amidination.pdf, PMID:12643539, PMID:6273432, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=141]
xref: record_id "141"
xref: delta_mono_mass "41.026549"
xref: delta_avge_mass "41.0519"
xref: delta_composition "H(3) C(2) N"
xref: username_of_poster "pnacman"
xref: group_of_poster "users"
xref: date_time_posted "2003-09-25 11:04:41"
xref: date_time_modified "2006-10-15 18:32:25"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:142
name: HexNAc(1)dHex(1)
def: "HexNAc1dHex1." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=142]
xref: record_id "142"
xref: delta_mono_mass "349.137281"
xref: delta_avge_mass "349.3337"
xref: delta_composition "dHex HexNAc"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2003-09-29 12:28:45"
xref: date_time_modified "2006-10-16 16:03:39"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:143
name: HexNAc(2)
def: "HexNAc2." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=143]
xref: record_id "143"
xref: delta_mono_mass "406.158745"
xref: delta_avge_mass "406.3850"
xref: delta_composition "HexNAc(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2003-09-29 12:37:55"
xref: date_time_modified "2006-10-16 16:43:09"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:144
name: Hex(3)
def: "Hex3." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=144]
xref: record_id "144"
xref: delta_mono_mass "486.158471"
xref: delta_avge_mass "486.4218"
xref: delta_composition "Hex(3)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2003-09-29 12:39:30"
xref: date_time_modified "2006-10-16 16:59:36"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:145
name: HexNAc(1)dHex(2)
def: "HexNAc1dHex2." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=145]
xref: record_id "145"
xref: delta_mono_mass "495.195190"
xref: delta_avge_mass "495.4749"
xref: delta_composition "dHex(2) HexNAc"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2003-09-29 12:40:57"
xref: date_time_modified "2006-10-16 17:01:52"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:146
name: Hex(1)HexNAc(1)dHex(1)
def: "Hex1HexNAc1dHex1." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=146]
xref: record_id "146"
xref: delta_mono_mass "511.190105"
xref: delta_avge_mass "511.4743"
xref: delta_composition "dHex Hex HexNAc"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2003-09-29 12:42:27"
xref: date_time_modified "2006-10-16 17:02:06"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:147
name: HexNAc(2)dHex(1)
def: "HexNAc2dHex1." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=147]
xref: record_id "147"
xref: delta_mono_mass "552.216654"
xref: delta_avge_mass "552.5262"
xref: delta_composition "dHex HexNAc(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2003-09-29 12:44:18"
xref: date_time_modified "2006-10-16 17:04:11"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:148
name: Hex(1)HexNAc(2)
def: "Hex1HexNAc2." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=148]
xref: record_id "148"
xref: delta_mono_mass "568.211569"
xref: delta_avge_mass "568.5256"
xref: delta_composition "Hex HexNAc(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2003-09-29 12:48:18"
xref: date_time_modified "2006-10-16 17:04:35"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:149
name: Hex(1)HexNAc(1)NeuAc(1)
def: "Hex1HexNAc1NeuAc1." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=149]
xref: record_id "149"
xref: delta_mono_mass "656.227613"
xref: delta_avge_mass "656.5877"
xref: delta_composition "Hex HexNAc NeuAc"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2003-09-29 12:51:19"
xref: date_time_modified "2007-10-20 19:29:29"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "S"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "O-linked glycosylation"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "T"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "O-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:150
name: HexNAc(2)dHex(2)
def: "HexNAc2dHex2." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=150]
xref: record_id "150"
xref: delta_mono_mass "698.274563"
xref: delta_avge_mass "698.6674"
xref: delta_composition "dHex(2) HexNAc(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2003-09-29 12:52:36"
xref: date_time_modified "2006-10-16 17:11:45"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:151
name: Hex(1)HexNAc(2)Pent(1)
def: "Hex1HexNAc2Pent1." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=151]
xref: record_id "151"
xref: delta_mono_mass "700.253828"
xref: delta_avge_mass "700.6403"
xref: delta_composition "Pent Hex HexNAc(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2003-09-29 12:53:29"
xref: date_time_modified "2006-10-16 17:12:02"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:152
name: Hex(1)HexNAc(2)dHex(1)
def: "Hex1HexNAc2dHex1." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=152]
xref: record_id "152"
xref: delta_mono_mass "714.269478"
xref: delta_avge_mass "714.6668"
xref: delta_composition "dHex Hex HexNAc(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2003-09-29 12:54:18"
xref: date_time_modified "2006-10-16 17:12:59"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:153
name: Hex(2)HexNAc(2)
def: "Hex2HexNAc2." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=153]
xref: record_id "153"
xref: delta_mono_mass "730.264392"
xref: delta_avge_mass "730.6662"
xref: delta_composition "Hex(2) HexNAc(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2003-09-29 12:55:08"
xref: date_time_modified "2006-10-16 17:13:17"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:154
name: Hex(3)HexNAc(1)Pent(1)
def: "Hex3HexNAc1Pent1." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=154]
xref: record_id "154"
xref: delta_mono_mass "821.280102"
xref: delta_avge_mass "821.7289"
xref: delta_composition "Pent Hex(3) HexNAc"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2003-09-29 12:56:02"
xref: date_time_modified "2006-10-16 17:18:03"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:155
name: Hex(1)HexNAc(2)dHex(1)Pent(1)
def: "Hex1HexNAc2dHex1Pent1." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=155]
xref: record_id "155"
xref: delta_mono_mass "846.311736"
xref: delta_avge_mass "846.7815"
xref: delta_composition "Pent dHex Hex HexNAc(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2003-09-29 12:57:01"
xref: date_time_modified "2006-10-16 17:18:41"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:156
name: Hex(1)HexNAc(2)dHex(2)
def: "Hex1HexNAc2dHex2." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=156]
xref: record_id "156"
xref: delta_mono_mass "860.327386"
xref: delta_avge_mass "860.8080"
xref: delta_composition "dHex(2) Hex HexNAc(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2003-09-29 12:57:52"
xref: date_time_modified "2006-10-16 17:18:56"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:157
name: Hex(2)HexNAc(2)Pent(1)
def: "Hex2HexNAc2Pent1." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=157]
xref: record_id "157"
xref: delta_mono_mass "862.306651"
xref: delta_avge_mass "862.7809"
xref: delta_composition "Pent Hex(2) HexNAc(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2003-09-29 12:58:38"
xref: date_time_modified "2006-10-16 17:19:11"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:158
name: Hex(2)HexNAc(2)dHex(1)
def: "Hex2HexNAc2dHex1." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=158]
xref: record_id "158"
xref: delta_mono_mass "876.322301"
xref: delta_avge_mass "876.8074"
xref: delta_composition "dHex Hex(2) HexNAc(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2003-09-29 12:59:18"
xref: date_time_modified "2006-10-16 17:19:27"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:159
name: Hex(3)HexNAc(2)
def: "Hex3HexNAc2." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=159]
synonym: "chitobiose core" []
xref: record_id "159"
xref: delta_mono_mass "892.317216"
xref: delta_avge_mass "892.8068"
xref: delta_composition "Hex(3) HexNAc(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2003-09-29 12:59:59"
xref: date_time_modified "2006-10-16 17:19:58"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:160
name: Hex(1)HexNAc(1)NeuAc(2)
def: "Hex1HexNAc1NeuAc2." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=160]
xref: record_id "160"
xref: delta_mono_mass "947.323029"
xref: delta_avge_mass "947.8423"
xref: delta_composition "Hex HexNAc NeuAc(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2003-09-29 13:01:06"
xref: date_time_modified "2007-10-20 19:30:21"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "S"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "O-linked glycosylation"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "T"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "O-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:161
name: Hex(3)HexNAc(2)P(1)
def: "Hex3HexNAc2P1." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=161]
xref: record_id "161"
xref: delta_mono_mass "923.290978"
xref: delta_avge_mass "923.7806"
xref: delta_composition "P Hex(3) HexNAc(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2003-09-29 13:02:02"
xref: date_time_modified "2006-10-16 17:20:48"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:162
name: Delta:S(-1)Se(1)
def: "Selenium replaces sulphur." [PMID:12148805, RESID:AA0022, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=162]
xref: record_id "162"
xref: delta_mono_mass "47.944449"
xref: delta_avge_mass "46.8950"
xref: delta_composition "S(-1) Se"
xref: username_of_poster "pnacman"
xref: group_of_poster "users"
xref: date_time_posted "2003-10-14 11:24:28"
xref: date_time_modified "2006-10-16 10:11:58"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "M"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Non-standard residue"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "C"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Non-standard residue"
xref: spec_2_misc_notes "Selenocysteine conventionally represented by 1 letter code U"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:170
name: Delta:H(1)O(-1)18O(1)
def: "Glycosylated asparagine 18O labeling." [PMID:1443554, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=170]
comment: Conversion of glycosylated asparagine residues upon deglycosylation with PGNase F in 18O labelled water.
xref: record_id "170"
xref: delta_mono_mass "2.988261"
xref: delta_avge_mass "2.9845"
xref: delta_composition "H(-1) N(-1) 18O"
xref: username_of_poster "lobvi"
xref: group_of_poster "users"
xref: date_time_posted "2003-12-11 18:24:58"
xref: date_time_modified "2009-06-26 17:35:41"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:171
name: NBS:13C(6)
def: "Shimadzu NBS-13C." [PMID:12845591, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=171]
synonym: "NBS reagent heavy" []
xref: record_id "171"
xref: delta_mono_mass "159.008578"
xref: delta_avge_mass "159.1144"
xref: delta_composition "H(3) 13C(6) N O(2) S"
xref: username_of_poster "kuyama"
xref: group_of_poster "users"
xref: date_time_posted "2004-01-07 07:22:34"
xref: date_time_modified "2007-08-31 10:35:22"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "W"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:172
name: NBS
def: "Shimadzu NBS-12C." [PMID:12845591, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=172]
synonym: "2-nitrobenzenesulfenyl" []
xref: record_id "172"
xref: delta_mono_mass "152.988449"
xref: delta_avge_mass "153.1585"
xref: delta_composition "H(3) C(6) N O(2) S"
xref: username_of_poster "kuyama"
xref: group_of_poster "users"
xref: date_time_posted "2004-01-07 07:25:07"
xref: date_time_modified "2007-08-31 10:34:53"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "W"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:176
name: BHT
def: "Michael addition of BHT quinone methide to Cysteine and Lysine." [PMID:9448752, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=176]
comment: BHT metabolism has been studied in rats and mice in relation to tumor promotion.
synonym: "Butylated Hydroxytoluene" []
xref: record_id "176"
xref: delta_mono_mass "218.167065"
xref: delta_avge_mass "218.3346"
xref: delta_composition "H(22) C(15) O"
xref: username_of_poster "gonzo"
xref: group_of_poster "users"
xref: date_time_posted "2004-02-05 22:02:53"
xref: date_time_modified "2006-10-16 15:19:41"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
xref: spec_1_misc_notes "Secondary adduct - much less common as C"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "H"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Other"
xref: spec_2_misc_notes "Secondary adduct - much less common as C"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "C"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Other"
xref: spec_3_misc_notes "Primary adduct formed"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:178
name: DAET
def: "Phosphorylation to amine thiol." [PMID:12216740, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=178]
comment: DAET = 2-(dimethylamino)ethanethiol; The phosphorylation to amine is the beta elimination of phosphate and Michael addition of 2-(dimethylamino)ethanethiol to the site.
synonym: "b-elimination thiol derivatization" []
xref: record_id "178"
xref: delta_mono_mass "87.050655"
xref: delta_avge_mass "87.1866"
xref: delta_composition "H(9) C(4) N O(-1) S"
xref: username_of_poster "chemgirl18"
xref: group_of_poster "users"
xref: date_time_posted "2004-02-11 20:34:16"
xref: date_time_modified "2006-10-16 12:34:48"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:184
name: Label:13C(9)
def: "13C(9) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, PMID:12716131, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=184]
synonym: "heavy tyrosine" []
xref: record_id "184"
xref: delta_mono_mass "9.030193"
xref: delta_avge_mass "8.9339"
xref: delta_composition "C(-9) 13C(9)"
xref: username_of_poster "hs"
xref: group_of_poster "users"
xref: date_time_posted "2004-02-16 21:19:47"
xref: date_time_modified "2007-08-22 18:31:52"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Y"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_1_misc_notes "Used in SILAC experiment"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "F"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:185
name: Label:13C(9)+Phospho
def: "C13 label (Phosphotyrosine)." [PMID:12716131, URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=185]
synonym: "heavy phosphotyrosine" []
xref: record_id "185"
xref: delta_mono_mass "88.996524"
xref: delta_avge_mass "88.9138"
xref: delta_composition "H C(-9) 13C(9) O(3) P"
xref: username_of_poster "hs"
xref: group_of_poster "users"
xref: date_time_posted "2004-02-22 04:42:33"
xref: date_time_modified "2006-10-16 12:37:51"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Y"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_1_misc_notes "Used in SILAC experiment"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:186
name: HPG
def: "Hydroxyphenylglyoxal arginine." [PMID:11698400, PMID:11914093, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=186]
synonym: "HPG arginine" []
xref: record_id "186"
xref: delta_mono_mass "132.021129"
xref: delta_avge_mass "132.1162"
xref: delta_composition "H(4) C(8) O(2)"
xref: username_of_poster "gcarven"
xref: group_of_poster "users"
xref: date_time_posted "2004-02-26 20:19:25"
xref: date_time_modified "2006-10-17 11:46:39"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:187
name: 2HPG
def: "Bis(hydroxphenylglyoxal) arginine." [PMID:11698400, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=187]
comment: OH-PGO and PGO react with arginine at a stoichiometry of 2:1.
xref: record_id "187"
xref: delta_mono_mass "282.052824"
xref: delta_avge_mass "282.2476"
xref: delta_composition "H(10) C(16) O(5)"
xref: username_of_poster "gcarven"
xref: group_of_poster "users"
xref: date_time_posted "2004-02-26 22:05:25"
xref: date_time_modified "2009-06-26 17:37:17"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:188
name: Label:13C(6)
def: "13C(6) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, PMID:12716131, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=188]
xref: record_id "188"
xref: delta_mono_mass "6.020129"
xref: delta_avge_mass "5.9559"
xref: delta_composition "C(-6) 13C(6)"
xref: username_of_poster "hs"
xref: group_of_poster "users"
xref: date_time_posted "2004-02-28 19:54:10"
xref: date_time_modified "2007-08-22 18:29:56"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_1_misc_notes "Used in SILAC experiment"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Isotopic label"
xref: spec_2_misc_notes "Used in SILAC experiment"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "L"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Isotopic label"
xref: spec_3_misc_notes "Used in SILAC experiment"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "I"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Isotopic label"
xref: spec_5_misc_notes "Used in SILAC experiment"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:193
name: Label:18O(2)
def: "O18 label at both C-terminal oxygens." [PMID:11467524, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=193]
synonym: "Double O18 (C-term)" []
xref: record_id "193"
xref: delta_mono_mass "4.008491"
xref: delta_avge_mass "3.9995"
xref: delta_composition "O(-2) 18O(2)"
xref: username_of_poster "Hensbergen"
xref: group_of_poster "users"
xref: date_time_posted "2004-03-30 14:20:29"
xref: date_time_modified "2006-11-14 12:01:04"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "C-term"
xref: spec_1_position "Any C-term"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:194
name: AccQTag
def: "6-aminoquinolyl-N-hydroxysuccinimidyl carbamate." [URL:http\://www2.waters.com/watprod.nsf/newdocs/930494, PMID:14997490, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=194]
xref: record_id "194"
xref: delta_mono_mass "170.048013"
xref: delta_avge_mass "170.1674"
xref: delta_composition "H(6) C(10) N(2) O"
xref: username_of_poster "davidcreasy"
xref: group_of_poster "users"
xref: date_time_posted "2004-04-08 12:01:19"
xref: date_time_modified "2006-10-16 14:59:12"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:195
name: QAT
def: "APTA-d0." [PMID:15283597, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=195]
synonym: "(3-acrylamidopropyl)trimethylammonium" []
xref: record_id "195"
xref: delta_mono_mass "171.149738"
xref: delta_avge_mass "171.2600"
xref: delta_composition "H(19) C(9) N(2) O"
xref: username_of_poster "s_julka"
xref: group_of_poster "users"
xref: date_time_posted "2004-04-08 17:12:14"
xref: date_time_modified "2009-06-26 17:39:29"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:196
name: QAT:2H(3)
def: "APTA d3." [PMID:15283597, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=196]
synonym: "(3-acrylamidopropyl)trimethylammonium" []
xref: record_id "196"
xref: delta_mono_mass "174.168569"
xref: delta_avge_mass "174.2784"
xref: delta_composition "H(16) 2H(3) C(9) N(2) O"
xref: username_of_poster "s_julka"
xref: group_of_poster "users"
xref: date_time_posted "2004-04-08 17:15:04"
xref: date_time_modified "2006-10-16 15:01:35"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:197
name: EQAT
def: "EAPTA d0." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=197]
xref: record_id "197"
xref: delta_mono_mass "184.157563"
xref: delta_avge_mass "184.2786"
xref: delta_composition "H(20) C(10) N(2) O"
xref: username_of_poster "s_julka"
xref: group_of_poster "users"
xref: date_time_posted "2004-04-08 17:21:08"
xref: date_time_modified "2006-10-16 15:05:02"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:198
name: EQAT:2H(5)
def: "EAPTA d5." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=198]
xref: record_id "198"
xref: delta_mono_mass "189.188947"
xref: delta_avge_mass "189.3094"
xref: delta_composition "H(15) 2H(5) C(10) N(2) O"
xref: username_of_poster "s_julka"
xref: group_of_poster "users"
xref: date_time_posted "2004-04-08 17:25:24"
xref: date_time_modified "2006-10-16 15:07:31"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:199
name: Dimethyl:2H(4)
def: "DiMethyl-CHD2." [PMID:14670044, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=199]
synonym: "reductive amination" []
xref: record_id "199"
xref: delta_mono_mass "32.056407"
xref: delta_avge_mass "32.0778"
xref: delta_composition "2H(4) C(2)"
xref: username_of_poster "PhilipHsu"
xref: group_of_poster "users"
xref: date_time_posted "2004-04-20 07:07:29"
xref: date_time_modified "2006-10-15 18:24:07"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N-term"
xref: spec_3_position "Protein N-term"
xref: spec_3_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:200
name: Ethanedithiol
def: "EDT." [PMID:11507762, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=200]
xref: record_id "200"
xref: delta_mono_mass "75.980527"
xref: delta_avge_mass "76.1838"
xref: delta_composition "H(4) C(2) O(-1) S(2)"
xref: username_of_poster "take"
xref: group_of_poster "users"
xref: date_time_posted "2004-04-20 08:27:30"
xref: date_time_modified "2006-10-16 11:07:38"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:205
name: Delta:H(6)C(6)O(1)
def: "Acrolein addition +94." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=205]
synonym: "Acrolein94, FDP" []
xref: record_id "205"
xref: delta_mono_mass "94.041865"
xref: delta_avge_mass "94.1112"
xref: delta_composition "H(6) C(6) O"
xref: username_of_poster "fatcat"
xref: group_of_poster "users"
xref: date_time_posted "2004-05-06 18:54:17"
xref: date_time_modified "2006-10-16 12:38:28"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:206
name: Delta:H(4)C(3)O(1)
def: "Acrolein addition +56." [PMID:10825247, PMID:15541752, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=206]
synonym: "Acrolein56" []
xref: record_id "206"
xref: delta_mono_mass "56.026215"
xref: delta_avge_mass "56.0633"
xref: delta_composition "H(4) C(3) O"
xref: username_of_poster "fatcat"
xref: group_of_poster "users"
xref: date_time_posted "2004-05-06 18:55:58"
xref: date_time_modified "2006-10-16 10:16:29"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "H"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Other"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "K"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Other"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:207
name: Delta:H(2)C(3)
def: "Acrolein addition +38." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=207]
synonym: "Acrolein38" []
xref: record_id "207"
xref: delta_mono_mass "38.015650"
xref: delta_avge_mass "38.0480"
xref: delta_composition "H(2) C(3)"
xref: username_of_poster "fatcat"
xref: group_of_poster "users"
xref: date_time_posted "2004-05-06 18:57:08"
xref: date_time_modified "2006-10-15 18:30:31"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:208
name: Delta:H(4)C(6)
def: "Acrolein addition +76." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=208]
synonym: "Acrolein76" []
xref: record_id "208"
xref: delta_mono_mass "76.031300"
xref: delta_avge_mass "76.0960"
xref: delta_composition "H(4) C(6)"
xref: username_of_poster "fatcat"
xref: group_of_poster "users"
xref: date_time_posted "2004-05-06 18:59:23"
xref: date_time_modified "2006-10-16 11:08:13"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:209
name: Delta:H(8)C(6)O(2)
def: "Acrolein addition +112." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=209]
synonym: "Acrolein112" []
xref: record_id "209"
xref: delta_mono_mass "112.052430"
xref: delta_avge_mass "112.1265"
xref: delta_composition "H(8) C(6) O(2)"
xref: username_of_poster "fatcat"
xref: group_of_poster "users"
xref: date_time_posted "2004-05-06 19:00:25"
xref: date_time_modified "2006-10-16 12:46:03"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:211
name: NEIAA
def: "N-ethyl iodoacetamide-d0." [PMID:12766232, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=211]
xref: record_id "211"
xref: delta_mono_mass "85.052764"
xref: delta_avge_mass "85.1045"
xref: delta_composition "H(7) C(4) N O"
xref: username_of_poster "Botting"
xref: group_of_poster "users"
xref: date_time_posted "2004-05-18 11:10:37"
xref: date_time_modified "2006-10-16 12:15:11"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "Y"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:212
name: NEIAA:2H(5)
def: "N-ethyl iodoacetamide-d5." [PMID:12766232, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=212]
xref: record_id "212"
xref: delta_mono_mass "90.084148"
xref: delta_avge_mass "90.1353"
xref: delta_composition "H(2) 2H(5) C(4) N O"
xref: username_of_poster "Botting"
xref: group_of_poster "users"
xref: date_time_posted "2004-05-18 11:11:52"
xref: date_time_modified "2006-10-16 12:38:09"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "Y"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:213
name: ADP-Ribosyl
def: "ADP Ribose addition." [RESID:AA0231, RESID:AA0168, URL:http\://betelgeuse.u-strasbg.fr/DocPARP/DocPARG/images/Structure-pADPR.jpg, RESID:AA0169, RESID:AA0237, PMID:15842200, RESID:AA0295, FindMod:ADP, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=213]
xref: record_id "213"
xref: delta_mono_mass "541.061110"
xref: delta_avge_mass "541.3005"
xref: delta_composition "H(21) C(15) N(5) O(13) P(2)"
xref: username_of_poster "ionjockey"
xref: group_of_poster "users"
xref: date_time_posted "2004-05-27 20:53:37"
xref: date_time_modified "2011-10-20 13:50:11"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other glycosylation"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "C"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Other glycosylation"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Other glycosylation"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "S"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Other glycosylation"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "E"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Other glycosylation"
xref: spec_6_group "6"
xref: spec_6_hidden "1"
xref: spec_6_site "K"
xref: spec_6_position "Anywhere"
xref: spec_6_classification "Other glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:214
name: iTRAQ4plex
def: "Representative mass and accurate mass for 116 & 117." [URL:http\://docs.appliedbiosystems.com/pebiodocs/04351918.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=214]
comment: Different channels have the same nominal mass but slightly different exact masses. Use this value for all channels for quantitation purposes. mTRAQ heavy is identical to iTRAQ4plex 117.
synonym: "AKA iTRAQ4plex116/7 Applied Biosystems iTRAQ(TM) multiplexed quantitation chemistry" []
xref: record_id "214"
xref: delta_mono_mass "144.102063"
xref: delta_avge_mass "144.1544"
xref: delta_composition "H(12) C(4) 13C(3) N 15N O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2004-06-08 14:04:07"
xref: date_time_modified "2011-11-21 14:08:42"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "0"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_3_group "3"
xref: spec_3_hidden "0"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Isotopic label"
xref: spec_3_misc_notes "Low abundance"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "H"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Isotopic label"
xref: spec_4_misc_notes "Very low abundance"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "S"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Isotopic label"
xref: spec_5_misc_notes "Very low abundance"
xref: spec_6_group "6"
xref: spec_6_hidden "1"
xref: spec_6_site "T"
xref: spec_6_position "Anywhere"
xref: spec_6_classification "Isotopic label"
xref: spec_6_misc_notes "Very low abundance"
xref: spec_7_group "7"
xref: spec_7_hidden "1"
xref: spec_7_site "N-term"
xref: spec_7_position "Protein N-term"
xref: spec_7_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:243
name: IGBP
def: "Light IDBEST tag for quantitation." [URL:http\://www.targetdiscovery.com/index.php?topic=prod.idbe, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=243]
xref: record_id "243"
xref: delta_mono_mass "296.016039"
xref: delta_avge_mass "297.1478"
xref: delta_composition "H(13) C(12) N(2) O(2) Br"
xref: username_of_poster "zqiao"
xref: group_of_poster "users"
xref: date_time_posted "2004-07-26 23:02:04"
xref: date_time_modified "2006-10-19 11:13:26"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:253
name: Crotonaldehyde
def: "Crotonaldehyde." [PMID:11283024, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=253]
xref: record_id "253"
xref: delta_mono_mass "70.041865"
xref: delta_avge_mass "70.0898"
xref: delta_composition "H(6) C(4) O"
xref: username_of_poster "fatcat"
xref: group_of_poster "users"
xref: date_time_posted "2004-08-12 19:56:03"
xref: date_time_modified "2006-10-16 10:35:31"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "H"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Other"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "K"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Other"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:254
name: Delta:H(2)C(2)
def: "Acetaldehyde +26." [PMID:7744761, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=254]
comment: Lys modification is formation of Schiff base.
xref: record_id "254"
xref: delta_mono_mass "26.015650"
xref: delta_avge_mass "26.0373"
xref: delta_composition "H(2) C(2)"
xref: username_of_poster "fatcat"
xref: group_of_poster "users"
xref: date_time_posted "2004-08-12 20:01:03"
xref: date_time_modified "2011-11-21 13:14:17"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "H"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Other"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N-term"
xref: spec_3_position "Protein N-term"
xref: spec_3_classification "Other"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "N-term"
xref: spec_4_position "Any N-term"
xref: spec_4_classification "Other"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:255
name: Delta:H(4)C(2)
def: "Acetaldehyde +28." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=255]
comment: Reduction of Schiff base formed between K amino group and acetaldehyde.
xref: record_id "255"
xref: delta_mono_mass "28.031300"
xref: delta_avge_mass "28.0532"
xref: delta_composition "H(4) C(2)"
xref: username_of_poster "fatcat"
xref: group_of_poster "users"
xref: date_time_posted "2004-08-12 20:02:38"
xref: date_time_modified "2011-11-21 13:14:58"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "H"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Other"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N-term"
xref: spec_3_position "Any N-term"
xref: spec_3_classification "Other"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:256
name: Delta:H(4)C(3)
def: "Propionaldehyde +40." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=256]
xref: record_id "256"
xref: delta_mono_mass "40.031300"
xref: delta_avge_mass "40.0639"
xref: delta_composition "H(4) C(3)"
xref: username_of_poster "fatcat"
xref: group_of_poster "users"
xref: date_time_posted "2004-08-12 20:04:01"
xref: date_time_modified "2010-02-25 10:49:55"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "H"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Other"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N-term"
xref: spec_3_position "Protein N-term"
xref: spec_3_classification "Other"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:258
name: Label:18O(1)
def: "O18 Labeling." [PMID:11467524, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=258]
synonym: "H2 18O Alkaline Phosphatase" []
xref: record_id "258"
xref: delta_mono_mass "2.004246"
xref: delta_avge_mass "1.9998"
xref: delta_composition "O(-1) 18O"
xref: username_of_poster "chemgirl18"
xref: group_of_poster "users"
xref: date_time_posted "2004-08-27 21:57:17"
xref: date_time_modified "2006-10-13 18:53:41"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_1_misc_notes "alkaline phosphatase to dephosphorylate"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Isotopic label"
xref: spec_2_misc_notes "alkaline phosphatase to dephosphorylate"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Isotopic label"
xref: spec_3_misc_notes "alkaline phosphatase to dephosphorylate"
xref: spec_4_group "4"
xref: spec_4_hidden "0"
xref: spec_4_site "C-term"
xref: spec_4_position "Any C-term"
xref: spec_4_classification "Isotopic label"
xref: spec_4_misc_notes "digesting in labelled water"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:259
name: Label:13C(6)15N(2)
def: "13C(6) 15N(2) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, PMID:12716131, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=259]
synonym: "heavy lysine" []
xref: record_id "259"
xref: delta_mono_mass "8.014199"
xref: delta_avge_mass "7.9427"
xref: delta_composition "C(-6) 13C(6) N(-2) 15N(2)"
xref: username_of_poster "hs01"
xref: group_of_poster "users"
xref: date_time_posted "2004-08-30 16:23:02"
xref: date_time_modified "2011-11-21 14:49:27"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_1_misc_notes "Used in SILAC experiment"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "L"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:260
name: Thiophospho
def: "Thiophosphorylation." [PMID:12110917, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=260]
xref: record_id "260"
xref: delta_mono_mass "95.943487"
xref: delta_avge_mass "96.0455"
xref: delta_composition "H O(2) P S"
xref: username_of_poster "mrbladergroen"
xref: group_of_poster "users"
xref: date_time_posted "2004-09-01 13:20:58"
xref: date_time_modified "2006-10-16 12:38:48"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Other"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Other"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:261
name: SPITC
def: "4-sulfophenyl isothiocyanate." [URL:http\://www.shimadzu-biotech.net/literature/application_note/202_1.pdf, PMID:14745769, PMID:14689565, PMID:16526082, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=261]
synonym: "N-terminal / lysine sulfonation" []
xref: record_id "261"
xref: delta_mono_mass "214.971084"
xref: delta_avge_mass "215.2495"
xref: delta_composition "H(5) C(7) N O(3) S(2)"
xref: username_of_poster "hatlevig"
xref: group_of_poster "users"
xref: date_time_posted "2004-09-14 20:01:29"
xref: date_time_modified "2006-10-16 15:26:00"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:262
name: Label:2H(3)
def: "Trideuteration." [URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=262]
synonym: "Trideuteration" []
xref: record_id "262"
xref: delta_mono_mass "3.018830"
xref: delta_avge_mass "3.0185"
xref: delta_composition "H(-3) 2H(3)"
xref: username_of_poster "mmolloy"
xref: group_of_poster "users"
xref: date_time_posted "2004-09-29 08:52:01"
xref: date_time_modified "2006-10-14 09:38:54"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "L"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_1_misc_notes "for SILAC expt"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:264
name: PET
def: "Phosphorylation to pyridyl thiol." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=264]
comment: PET = 2-[4-pyridyl]ethanethiol. This modification is a chemical derivative, based on a alkaline catalysed beta-elimination of phosphoserines and phosphothreonines and subsequent 1,4-addition of 2-[4-pyridine]ethanethiol. These modified serines and threonines produce in MS/MS a characteristic fragment which can be used for precursor-ion-scan experiments.
synonym: "b-elimination PET derivatisation" []
xref: record_id "264"
xref: delta_mono_mass "121.035005"
xref: delta_avge_mass "121.2028"
xref: delta_composition "H(7) C(7) N O(-1) S"
xref: username_of_poster "vbad"
xref: group_of_poster "users"
xref: date_time_posted "2004-10-07 08:55:33"
xref: date_time_modified "2006-10-16 12:48:51"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:267
name: Label:13C(6)15N(4)
def: "13C(6) 15N(4) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, PMID:12716131, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=267]
xref: record_id "267"
xref: delta_mono_mass "10.008269"
xref: delta_avge_mass "9.9296"
xref: delta_composition "C(-6) 13C(6) N(-4) 15N(4)"
xref: username_of_poster "AFCS"
xref: group_of_poster "users"
xref: date_time_posted "2004-10-20 17:49:33"
xref: date_time_modified "2006-10-19 10:30:51"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_1_misc_notes "Used in SILAC experiment"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:268
name: Label:13C(5)15N(1)
def: "13C(5) 15N(1) Silac label." [PMID:12771378, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=268]
xref: record_id "268"
xref: delta_mono_mass "6.013809"
xref: delta_avge_mass "5.9567"
xref: delta_composition "C(-5) 13C(5) N(-1) 15N"
xref: username_of_poster "Deepa"
xref: group_of_poster "users"
xref: date_time_posted "2004-11-05 18:49:37"
xref: date_time_modified "2011-11-21 14:48:39"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "V"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_1_misc_notes "Used in AQUA experiment"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "P"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Isotopic label"
xref: spec_2_misc_notes "Result of conversion of 13C6, 15N4 arginine to 13C5, 15N1 proline"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "M"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Isotopic label"
xref: spec_3_misc_notes "SILAC label used in COFRADIC"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "E"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:269
name: Label:13C(9)15N(1)
def: "13C(9) 15N(1) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, PMID:12771378, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=269]
xref: record_id "269"
xref: delta_mono_mass "10.027228"
xref: delta_avge_mass "9.9273"
xref: delta_composition "C(-9) 13C(9) N(-1) 15N"
xref: username_of_poster "Deepa"
xref: group_of_poster "users"
xref: date_time_posted "2004-11-05 18:51:13"
xref: date_time_modified "2006-10-19 10:31:10"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "F"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_1_misc_notes "Used in AQUA experiment"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:270
name: Cytopiloyne
def: "Nucleophilic addtion to cytopiloyne." [PMID:15549660, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=270]
comment: Cytopiloyne is a polyacetylenic glucoside isolated form Bidens pilosa which can modulate T helper cell differentiation. Biotinylated cytopiloyne might be use to identify its receptor in T cell.
xref: record_id "270"
xref: delta_mono_mass "362.136553"
xref: delta_avge_mass "362.3738"
xref: delta_composition "H(22) C(19) O(7)"
xref: username_of_poster "ymchiang"
xref: group_of_poster "users"
xref: date_time_posted "2004-11-10 03:13:23"
xref: date_time_modified "2006-10-16 16:35:54"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N-term"
xref: spec_3_position "Any N-term"
xref: spec_3_classification "Chemical derivative"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "P"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Chemical derivative"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "R"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Chemical derivative"
xref: spec_6_group "6"
xref: spec_6_hidden "1"
xref: spec_6_site "S"
xref: spec_6_position "Anywhere"
xref: spec_6_classification "Chemical derivative"
xref: spec_7_group "7"
xref: spec_7_hidden "1"
xref: spec_7_site "Y"
xref: spec_7_position "Anywhere"
xref: spec_7_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:271
name: Cytopiloyne+water
def: "Nucleophilic addition to cytopiloyne+H2O." [PMID:15549660, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=271]
comment: Cytopiloyne is a polyacetylenic glucoside isolated form Bidens pilosa which can modulated T helper cell differentiation. Biotinylated cytopiloyne might be use to identify its receptor in T cell.
xref: record_id "271"
xref: delta_mono_mass "380.147118"
xref: delta_avge_mass "380.3891"
xref: delta_composition "H(24) C(19) O(8)"
xref: username_of_poster "ymchiang"
xref: group_of_poster "users"
xref: date_time_posted "2004-11-11 05:23:17"
xref: date_time_modified "2006-10-16 16:37:10"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N-term"
xref: spec_3_position "Any N-term"
xref: spec_3_classification "Chemical derivative"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "R"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Chemical derivative"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "S"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Chemical derivative"
xref: spec_6_group "6"
xref: spec_6_hidden "1"
xref: spec_6_site "T"
xref: spec_6_position "Anywhere"
xref: spec_6_classification "Chemical derivative"
xref: spec_7_group "7"
xref: spec_7_hidden "1"
xref: spec_7_site "Y"
xref: spec_7_position "Anywhere"
xref: spec_7_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:272
name: CAF
def: "Sulfonation of N-terminus." [PMID:15732931, PMID:16046801, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=272]
comment: N-terminal sulfonation of diglycine to detect ubiquitination sites.
synonym: "Ettan CAF MALDI" []
xref: record_id "272"
xref: delta_mono_mass "135.983029"
xref: delta_avge_mass "136.1265"
xref: delta_composition "H(4) C(3) O(4) S"
xref: username_of_poster "chens002"
xref: group_of_poster "users"
xref: date_time_posted "2004-11-16 14:25:33"
xref: date_time_modified "2007-01-03 19:34:35"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N-term"
xref: spec_1_position "Any N-term"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:273
name: Xlink:SSD
def: "Covalent modification of lysine by cross-linking reagent." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=273]
xref: record_id "273"
xref: delta_mono_mass "253.095023"
xref: delta_avge_mass "253.2512"
xref: delta_composition "H(15) C(12) N O(5)"
xref: username_of_poster "tom"
xref: group_of_poster "users"
xref: date_time_posted "2004-11-16 20:20:17"
xref: date_time_modified "2006-10-17 11:43:47"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:275
name: Nitrosyl
def: "S-nitrosylation." [RESID:AA0230, PMID:10442087, FindMod:NTRY, PMID:15688001, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=275]
comment: Protein which is posttranslationally modified by the attachment of a nitric oxide group on the sulfur atom of one or more cysteine residues.
xref: record_id "275"
xref: delta_mono_mass "28.990164"
xref: delta_avge_mass "28.9982"
xref: delta_composition "H(-1) N O"
xref: username_of_poster "dengh"
xref: group_of_poster "users"
xref: date_time_posted "2004-12-11 00:23:12"
xref: date_time_modified "2006-10-15 18:00:14"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:276
name: AEBS
def: "Aminoethylbenzenesulfonylation." [PMID:8597590, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=276]
comment: Potential protein modification when using AEBSF (Pefabloc) as a serine protease inhibitor.
xref: record_id "276"
xref: delta_mono_mass "183.035399"
xref: delta_avge_mass "183.2276"
xref: delta_composition "H(9) C(8) N O(2) S"
xref: username_of_poster "plattm"
xref: group_of_poster "users"
xref: date_time_posted "2004-12-14 04:38:25"
xref: date_time_modified "2006-10-16 15:04:42"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "H"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Artefact"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N-term"
xref: spec_3_position "Protein N-term"
xref: spec_3_classification "Artefact"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "S"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Artefact"
xref: spec_4_misc_notes "Primary site of modification"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "Y"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Artefact"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:278
name: Ethanolyl
def: "Ethanolation." [PMID:15351294, PMID:7730303, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=278]
synonym: "Hydroxy ethyl" []
xref: record_id "278"
xref: delta_mono_mass "44.026215"
xref: delta_avge_mass "44.0526"
xref: delta_composition "H(4) C(2) O"
xref: username_of_poster "knierman"
xref: group_of_poster "users"
xref: date_time_posted "2005-01-11 04:26:47"
xref: date_time_modified "2010-04-28 18:12:10"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_1_misc_notes "from reaction of SH group with iodoethanol"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_2_misc_notes "reduced form of oxidation product"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "R"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
xref: spec_3_misc_notes "reduced form of oxidation product"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:280
name: Ethyl
def: "Ethylation." [PMID:9629898, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=280]
xref: record_id "280"
xref: delta_mono_mass "28.031300"
xref: delta_avge_mass "28.0532"
xref: delta_composition "H(4) C(2)"
xref: username_of_poster "Qishanl"
xref: group_of_poster "users"
xref: date_time_posted "2005-01-27 23:18:07"
xref: date_time_modified "2009-10-02 18:28:37"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Multiple"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Multiple"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "E"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Artefact"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "N-term"
xref: spec_4_position "Protein N-term"
xref: spec_4_classification "Chemical derivative"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "C-term"
xref: spec_5_position "Any C-term"
xref: spec_5_classification "Chemical derivative"
xref: spec_6_group "6"
xref: spec_6_hidden "1"
xref: spec_6_site "D"
xref: spec_6_position "Anywhere"
xref: spec_6_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:281
name: CoenzymeA
def: "Cysteine modified Coenzyme A." [URL:http\://commons.wikimedia.org/wiki/Image\:Coenzyme_a.png, RESID:AA0306, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=281]
xref: record_id "281"
xref: delta_mono_mass "765.099560"
xref: delta_avge_mass "765.5182"
xref: delta_composition "H(34) C(21) N(7) O(16) P(3) S"
xref: username_of_poster "tremis"
xref: group_of_poster "users"
xref: date_time_posted "2005-02-01 17:10:00"
xref: date_time_modified "2006-10-16 17:15:18"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:284
name: Methyl:2H(2)
def: "Deuterium Methylation of Lysine." [PMID:15525938, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=284]
xref: record_id "284"
xref: delta_mono_mass "16.028204"
xref: delta_avge_mass "16.0389"
xref: delta_composition "2H(2) C"
xref: username_of_poster "Glebivanov"
xref: group_of_poster "users"
xref: date_time_posted "2005-02-13 01:26:38"
xref: date_time_modified "2006-10-14 19:35:54"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:285
name: SulfanilicAcid
def: "Light Sulfanilic Acid (SA) C12." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=285]
synonym: "C-Terminal/Glutamate/Aspartate sulfonation" []
xref: record_id "285"
xref: delta_mono_mass "155.004099"
xref: delta_avge_mass "155.1744"
xref: delta_composition "H(5) C(6) N O(2) S"
xref: username_of_poster "apanchaud"
xref: group_of_poster "users"
xref: date_time_posted "2005-02-17 15:48:07"
xref: date_time_modified "2006-10-16 14:05:34"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C-term"
xref: spec_1_position "Any C-term"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "D"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Isotopic label"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "E"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:286
name: SulfanilicAcid:13C(6)
def: "Heavy Sulfanilic Acid (SA) C13." [PMID:9254591, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=286]
synonym: "C-Terminal/Glutamate/Aspartate sulfonation" []
xref: record_id "286"
xref: delta_mono_mass "161.024228"
xref: delta_avge_mass "161.1303"
xref: delta_composition "H(5) 13C(6) N O(2) S"
xref: username_of_poster "apanchaud"
xref: group_of_poster "users"
xref: date_time_posted "2005-02-17 15:55:52"
xref: date_time_modified "2006-10-16 14:08:42"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C-term"
xref: spec_1_position "Any C-term"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "D"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "E"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:288
name: Trp->Oxolactone
def: "Tryptophan oxidation to oxolactone." [PMID:7949339, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=288]
comment: The cleavage of a peptide bond between Try-Xxx with oxidation of tryptophan to the oxolactone occurs in the presence of BNPS-skatole. This is a useful method for the chemical cleavage of proteins specifically at tryptophan residues.
xref: record_id "288"
xref: delta_mono_mass "13.979265"
xref: delta_avge_mass "13.9835"
xref: delta_composition "H(-2) O"
xref: username_of_poster "oxolactone"
xref: group_of_poster "users"
xref: date_time_posted "2005-02-25 23:30:20"
xref: date_time_modified "2006-10-14 10:06:01"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "W"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:289
name: Biotin-PEO-Amine
def: "Biotin polyethyleneoxide amine." [URL:http\://www.piercenet.com/Proteomics/browse.cfm?fldID=84EBE112-F871-4CA5-807F-47327153CFCB, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=289]
comment: EDC crosslinker is used to couple biotin PEO-amine to carboxyl groups or 5\' phosphate groups.
xref: record_id "289"
xref: delta_mono_mass "356.188212"
xref: delta_avge_mass "356.4835"
xref: delta_composition "H(28) C(16) N(4) O(3) S"
xref: username_of_poster "TBricker1"
xref: group_of_poster "users"
xref: date_time_posted "2005-03-02 16:49:17"
xref: date_time_modified "2006-11-14 11:15:23"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C-term"
xref: spec_1_position "Protein C-term"
xref: spec_1_classification "Chemical derivative"
xref: spec_1_misc_notes "EDC-coupled modification of D, E and C-terminus"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "D"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_2_misc_notes "EDC-coupled modification of D, E and C-terminus"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "E"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
xref: spec_3_misc_notes "EDC-coupled modification of D, E and C-terminus"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:290
name: Biotin-HPDP
def: "Pierce EZ-Link Biotin-HPDP." [URL:http\://www.piercenet.com/Products/Browse.cfm?fldID=01031002, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=290]
xref: record_id "290"
xref: delta_mono_mass "428.191582"
xref: delta_avge_mass "428.6124"
xref: delta_composition "H(32) C(19) N(4) O(3) S(2)"
xref: username_of_poster "tgreco"
xref: group_of_poster "users"
xref: date_time_posted "2005-03-03 22:56:52"
xref: date_time_modified "2010-12-03 16:28:07"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:291
name: Delta:Hg(1)
def: "Mercury Mercaptan." [PMID:10695144, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=291]
xref: record_id "291"
xref: delta_mono_mass "201.970617"
xref: delta_avge_mass "200.5900"
xref: delta_composition "Hg"
xref: username_of_poster "tgreco"
xref: group_of_poster "users"
xref: date_time_posted "2005-03-03 23:53:00"
xref: date_time_modified "2006-10-16 15:09:18"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:292
name: IodoU-AMP
def: "Cross-link of (Iodo)-uracil MP with W,F,Y." [PMID:6540775, PMID:11112526, PMID:11567090, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=292]
comment: One note about this chemistry is that for W you have to take care of O2 big time (and extract the I-uracil monophosphate with organics to get rid of residual iodide).
synonym: "UV induced cross-link product of Iodo-U-amp with WFY" []
xref: record_id "292"
xref: delta_mono_mass "322.020217"
xref: delta_avge_mass "322.1654"
xref: delta_composition "H(11) C(9) N(2) O(9) P"
xref: username_of_poster "davidERICanderson"
xref: group_of_poster "users"
xref: date_time_posted "2005-03-04 22:57:55"
xref: date_time_modified "2006-10-16 15:53:06"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "F"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_1_misc_notes "Used in base/residue interactions (in principle?)"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "W"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_2_misc_notes "Used in base/residue interactions (observed)"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
xref: spec_3_misc_notes "Used in base/residue interactions (in principle?)"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:293
name: CAMthiopropanoyl
def: "3-(carbamidomethylthio)propanoyl." [PMID:15121203, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=293]
synonym: "3-thiopropanoyl moiety from reduced DSP crosslinker or NHS-SS-biotin, modified with Iodoacetamide" []
xref: record_id "293"
xref: delta_mono_mass "145.019749"
xref: delta_avge_mass "145.1796"
xref: delta_composition "H(7) C(5) N O(2) S"
xref: username_of_poster "vanschra"
xref: group_of_poster "users"
xref: date_time_posted "2005-03-09 15:22:46"
xref: date_time_modified "2006-10-16 13:58:55"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Protein N-term"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:294
name: IED-Biotin
def: "Biotinoyl-iodoacetyl-ethylenediamine." [PMID:10906242, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=294]
xref: record_id "294"
xref: delta_mono_mass "326.141261"
xref: delta_avge_mass "326.4145"
xref: delta_composition "H(22) C(14) N(4) O(3) S"
xref: username_of_poster "alexey"
xref: group_of_poster "users"
xref: date_time_posted "2005-03-10 16:28:09"
xref: date_time_modified "2006-10-16 15:53:29"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:295
name: dHex
def: "Fucose." [PMID:11344537, PMID:15189151, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=295]
synonym: "deoxyhexose" []
xref: record_id "295"
xref: delta_mono_mass "146.057909"
xref: delta_avge_mass "146.1412"
xref: delta_composition "dHex"
xref: username_of_poster "rsack"
xref: group_of_poster "users"
xref: date_time_posted "2005-03-22 16:57:00"
xref: date_time_modified "2011-11-21 13:16:16"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "O-linked glycosylation"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "O-linked glycosylation"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "O-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:298
name: Methyl:2H(3)
def: "Deuterated methyl ester." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=298]
comment: Esterification of carboxylic acids using D3-Methanolic HCl.
xref: record_id "298"
xref: delta_mono_mass "17.034480"
xref: delta_avge_mass "17.0451"
xref: delta_composition "H(-1) 2H(3) C"
xref: username_of_poster "ndacoyas"
xref: group_of_poster "users"
xref: date_time_posted "2005-03-24 16:31:28"
xref: date_time_modified "2006-10-14 19:36:59"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C-term"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "D"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Isotopic label"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "E"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:299
name: Carboxy
def: "Carboxylation." [RESID:AA0114, FindMod:GGLU, RESID:AA0363, RESID:AA0032, PMID:3802193, RESID:AA0304, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=299]
xref: record_id "299"
xref: delta_mono_mass "43.989829"
xref: delta_avge_mass "44.0095"
xref: delta_composition "C O(2)"
xref: username_of_poster "Carol"
xref: group_of_poster "users"
xref: date_time_posted "2005-03-29 22:55:44"
xref: date_time_modified "2006-11-14 11:08:50"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "W"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "D"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Post-translational"
xref: spec_3_misc_notes "Gamma-carboxylation"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "E"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Post-translational"
xref: spec_4_misc_notes "Gamma-carboxylation"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "M"
xref: spec_5_position "Protein N-term"
xref: spec_5_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:301
name: Bromobimane
def: "Monobromobimane derivative." [PMID:7856876, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=301]
synonym: "mBromobimane" []
xref: record_id "301"
xref: delta_mono_mass "190.074228"
xref: delta_avge_mass "190.1986"
xref: delta_composition "H(10) C(10) N(2) O(2)"
xref: username_of_poster "catsriku"
xref: group_of_poster "users"
xref: date_time_posted "2005-04-04 23:03:13"
xref: date_time_modified "2006-10-16 15:07:49"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:302
name: Menadione
def: "Menadione quinone derivative." [PMID:15939799, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=302]
synonym: "Vitamin k3 (Q)" []
xref: record_id "302"
xref: delta_mono_mass "170.036779"
xref: delta_avge_mass "170.1641"
xref: delta_composition "H(6) C(11) O(2)"
xref: username_of_poster "catsriku"
xref: group_of_poster "users"
xref: date_time_posted "2005-04-04 23:21:29"
xref: date_time_modified "2007-07-12 07:36:32"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:303
name: DeStreak
def: "Cysteine mercaptoethanol." [PMID:12442261, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=303]
xref: record_id "303"
xref: delta_mono_mass "75.998285"
xref: delta_avge_mass "76.1176"
xref: delta_composition "H(4) C(2) O S"
xref: username_of_poster "harald"
xref: group_of_poster "users"
xref: date_time_posted "2005-04-11 14:06:08"
xref: date_time_modified "2006-10-16 11:07:55"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:305
name: dHex(1)Hex(3)HexNAc(4)
def: "Fucosylated biantennary (-2 galactose)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=305]
xref: record_id "305"
xref: delta_mono_mass "1444.533870"
xref: delta_avge_mass "1445.3331"
xref: delta_composition "dHex Hex(3) HexNAc(4)"
xref: username_of_poster "whaskins"
xref: group_of_poster "users"
xref: date_time_posted "2005-04-25 18:20:12"
xref: date_time_modified "2006-10-16 17:22:46"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:307
name: dHex(1)Hex(4)HexNAc(4)
def: "Fucosylated biantennary (-1 galactose)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=307]
xref: record_id "307"
xref: delta_mono_mass "1606.586693"
xref: delta_avge_mass "1607.4737"
xref: delta_composition "dHex Hex(4) HexNAc(4)"
xref: username_of_poster "whaskins"
xref: group_of_poster "users"
xref: date_time_posted "2005-04-25 19:22:11"
xref: date_time_modified "2006-10-16 17:23:48"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:308
name: dHex(1)Hex(5)HexNAc(4)
def: "Fucosylated biantennary." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=308]
xref: record_id "308"
xref: delta_mono_mass "1768.639517"
xref: delta_avge_mass "1769.6143"
xref: delta_composition "dHex Hex(5) HexNAc(4)"
xref: username_of_poster "whaskins"
xref: group_of_poster "users"
xref: date_time_posted "2005-04-25 19:25:17"
xref: date_time_modified "2006-10-16 17:24:49"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:309
name: Hex(3)HexNAc(4)
def: "Biantennary (-2 galactose)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=309]
xref: record_id "309"
xref: delta_mono_mass "1298.475961"
xref: delta_avge_mass "1299.1919"
xref: delta_composition "Hex(3) HexNAc(4)"
xref: username_of_poster "whaskins"
xref: group_of_poster "users"
xref: date_time_posted "2005-04-25 19:27:51"
xref: date_time_modified "2006-10-16 17:22:29"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:310
name: Hex(4)HexNAc(4)
def: "Biantennary (-1 galactose)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=310]
xref: record_id "310"
xref: delta_mono_mass "1460.528784"
xref: delta_avge_mass "1461.3325"
xref: delta_composition "Hex(4) HexNAc(4)"
xref: username_of_poster "whaskins"
xref: group_of_poster "users"
xref: date_time_posted "2005-04-25 19:33:37"
xref: date_time_modified "2006-10-16 17:23:05"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:311
name: Hex(5)HexNAc(4)
def: "Biantennary." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=311]
xref: record_id "311"
xref: delta_mono_mass "1622.581608"
xref: delta_avge_mass "1623.4731"
xref: delta_composition "Hex(5) HexNAc(4)"
xref: username_of_poster "whaskins"
xref: group_of_poster "users"
xref: date_time_posted "2005-04-25 19:35:54"
xref: date_time_modified "2006-10-16 17:24:34"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:312
name: Cysteinyl
def: "Cysteinylation." [RESID:AA0025, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=312]
xref: record_id "312"
xref: delta_mono_mass "119.004099"
xref: delta_avge_mass "119.1423"
xref: delta_composition "H(5) C(3) N O(2) S"
xref: username_of_poster "whaskins"
xref: group_of_poster "users"
xref: date_time_posted "2005-04-25 19:59:43"
xref: date_time_modified "2006-12-17 11:28:36"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Multiple"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:313
name: Lys-loss
def: "Loss of C-terminal K from Heavy Chain of MAb." [PMID:16078144, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=313]
xref: record_id "313"
xref: delta_mono_mass "-128.094963"
xref: delta_avge_mass "-128.1723"
xref: delta_composition "H(-12) C(-6) N(-2) O(-1)"
xref: username_of_poster "whaskins"
xref: group_of_poster "users"
xref: date_time_posted "2005-04-25 20:05:38"
xref: date_time_modified "2006-10-13 15:00:47"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Protein C-term"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:314
name: Nmethylmaleimide
def: "Nmethylmaleimide." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=314]
xref: record_id "314"
xref: delta_mono_mass "111.032028"
xref: delta_avge_mass "111.0987"
xref: delta_composition "H(5) C(5) N O(2)"
xref: username_of_poster "whaskins"
xref: group_of_poster "users"
xref: date_time_posted "2005-04-25 20:12:24"
xref: date_time_modified "2006-10-16 17:26:09"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:316
name: DimethylpyrroleAdduct
def: "2,5-dimethypyrrole." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=316]
xref: record_id "316"
xref: delta_mono_mass "78.046950"
xref: delta_avge_mass "78.1118"
xref: delta_composition "H(6) C(6)"
xref: username_of_poster "Qishanl"
xref: group_of_poster "users"
xref: date_time_posted "2005-05-07 03:11:23"
xref: date_time_modified "2006-10-16 11:14:22"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:318
name: Delta:H(2)C(5)
def: "MDA adduct +62." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=318]
comment: Usually major adduct formed from malondialdehyde (MDA) with the amino group of lysine residues.
synonym: "MDA62" []
xref: record_id "318"
xref: delta_mono_mass "62.015650"
xref: delta_avge_mass "62.0694"
xref: delta_composition "H(2) C(5)"
xref: username_of_poster "rkupfer"
xref: group_of_poster "users"
xref: date_time_posted "2005-05-12 22:00:21"
xref: date_time_modified "2006-10-16 10:29:55"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:319
name: Delta:H(2)C(3)O(1)
def: "MDA adduct +54." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=319]
synonym: "MDA54" []
xref: record_id "319"
xref: delta_mono_mass "54.010565"
xref: delta_avge_mass "54.0474"
xref: delta_composition "H(2) C(3) O"
xref: username_of_poster "rkupfer"
xref: group_of_poster "users"
xref: date_time_posted "2005-05-12 22:12:10"
xref: date_time_modified "2006-10-16 10:15:34"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_1_misc_notes "Malondialdehyde (MDA) adduct"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "R"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_2_misc_notes "5-hydro-5-methylimidazol-4-one, Methylglyoxal adduct"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:320
name: Nethylmaleimide+water
def: "Nethylmaleimidehydrolysis." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=320]
xref: record_id "320"
xref: delta_mono_mass "143.058243"
xref: delta_avge_mass "143.1406"
xref: delta_composition "H(9) C(6) N O(3)"
xref: username_of_poster "whaskins"
xref: group_of_poster "users"
xref: date_time_posted "2005-05-16 22:18:42"
xref: date_time_modified "2006-10-17 11:40:14"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:323
name: Xlink:B10621
def: "Bis-N-I-sulfonerahodamine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=323]
comment: Invitrogen X-link reagent.
xref: record_id "323"
xref: delta_mono_mass "713.093079"
xref: delta_avge_mass "713.5626"
xref: delta_composition "H(30) C(31) N(4) O(6) S I"
xref: username_of_poster "dengh"
xref: group_of_poster "users"
xref: date_time_posted "2005-05-17 22:56:12"
xref: date_time_modified "2006-10-16 17:12:41"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:324
name: DTBP
def: "Dimethyl 3,3\'-dithiobispropionimidate." [URL:http\://www.piercenet.com/files/0668ss5.pdf, PMID:770170, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=324]
comment: Imidoester cross-linker.
xref: record_id "324"
xref: delta_mono_mass "87.014270"
xref: delta_avge_mass "87.1435"
xref: delta_composition "H(5) C(3) N S"
xref: username_of_poster "takesin"
xref: group_of_poster "users"
xref: date_time_posted "2005-05-18 08:43:26"
xref: date_time_modified "2006-11-14 11:16:21"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "Q"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "R"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "K"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Chemical derivative"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "N-term"
xref: spec_5_position "Protein N-term"
xref: spec_5_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:325
name: FP-Biotin
def: "10-ethoxyphosphinyl-N-(biotinamidopentyl)decanamide." [PMID:10611275, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=325]
comment: FP-biotin was designed to label the active site serine of serine esterases/proteases.
synonym: "O-ethyl-N-(biotinamidopentyl)decanamido phosphonate" []
xref: record_id "325"
xref: delta_mono_mass "572.316129"
xref: delta_avge_mass "572.7405"
xref: delta_composition "H(49) C(27) N(4) O(5) P S"
xref: username_of_poster "lmschopfer"
xref: group_of_poster "users"
xref: date_time_posted "2005-05-19 22:01:37"
xref: date_time_modified "2010-02-24 20:54:27"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "Y"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "T"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "K"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:327
name: Delta:H(4)C(2)O(-1)S(1)
def: "S-Ethylcystine from Serine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=327]
comment: Phosphoserine to S-ethylcystine via Beta elimination/Michael addition of ethylthiol.
xref: record_id "327"
xref: delta_mono_mass "44.008456"
xref: delta_avge_mass "44.1188"
xref: delta_composition "H(4) C(2) O(-1) S"
xref: username_of_poster "UCDMSF"
xref: group_of_poster "users"
xref: date_time_posted "2005-06-20 20:09:02"
xref: date_time_modified "2006-10-16 10:00:57"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:329
name: Methyl:2H(3)13C(1)
def: "Monomethylated arginine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=329]
xref: record_id "329"
xref: delta_mono_mass "18.037835"
xref: delta_avge_mass "18.0377"
xref: delta_composition "H(-1) 2H(3) 13C"
xref: username_of_poster "sams"
xref: group_of_poster "users"
xref: date_time_posted "2005-06-30 18:19:34"
xref: date_time_modified "2006-10-14 19:40:53"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:330
name: Dimethyl:2H(6)13C(2)
def: "Dimethylated arginine." [PMID:15782174, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=330]
xref: record_id "330"
xref: delta_mono_mass "36.075670"
xref: delta_avge_mass "36.0754"
xref: delta_composition "H(-2) 2H(6) 13C(2)"
xref: username_of_poster "sams"
xref: group_of_poster "users"
xref: date_time_posted "2005-06-30 18:21:32"
xref: date_time_modified "2011-07-18 11:27:58"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Isotopic label"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N-term"
xref: spec_3_position "Any N-term"
xref: spec_3_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:332
name: Thiophos-S-S-biotin
def: "Thiophosphate labeled with biotin-HPDP." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=332]
synonym: "Thiophos-biotin disulfide" []
xref: record_id "332"
xref: delta_mono_mass "525.142894"
xref: delta_avge_mass "525.6658"
xref: delta_composition "H(34) C(19) N(4) O(5) P S(3)"
xref: username_of_poster "lparker"
xref: group_of_poster "users"
xref: date_time_posted "2005-07-21 16:37:10"
xref: date_time_modified "2006-10-16 17:02:42"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_1_neutral_loss_526_mono_mass "525.142894"
xref: spec_1_neutral_loss_526_avge_mass "525.6658"
xref: spec_1_neutral_loss_526_flag "false"
xref: spec_1_neutral_loss_526_composition "H(34) C(19) N(4) O(5) P S(3)"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_2_neutral_loss_526_mono_mass "525.142894"
xref: spec_2_neutral_loss_526_avge_mass "525.6658"
xref: spec_2_neutral_loss_526_flag "false"
xref: spec_2_neutral_loss_526_composition "H(34) C(19) N(4) O(5) P S(3)"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
xref: spec_3_neutral_loss_526_mono_mass "525.142894"
xref: spec_3_neutral_loss_526_avge_mass "525.6658"
xref: spec_3_neutral_loss_526_flag "false"
xref: spec_3_neutral_loss_526_composition "H(34) C(19) N(4) O(5) P S(3)"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:333
name: Can-FP-biotin
def: "6-N-biotinylaminohexyl isopropyl phosphate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=333]
comment: Commercially available from Toronto Research Chemicals Inc, as of 2005. Designed to label the active site serine of serine esterases/proteases.
synonym: "O-isopropyl-N-biotinylaminohexyl phosphonate" []
xref: record_id "333"
xref: delta_mono_mass "447.195679"
xref: delta_avge_mass "447.5291"
xref: delta_composition "H(34) C(19) N(3) O(5) P S"
xref: username_of_poster "lmschopfer"
xref: group_of_poster "users"
xref: date_time_posted "2005-07-21 20:54:00"
xref: date_time_modified "2010-12-03 16:24:45"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "Y"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "T"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:335
name: HNE+Delta:H(2)
def: "Reduced 4-Hydroxynonenal." [PMID:11910026, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=335]
comment: Michael addition adduct of 4-hydroxynonenal with histidine, cystein and lysine residues stabilized by reduction with NaBH4.
xref: record_id "335"
xref: delta_mono_mass "158.130680"
xref: delta_avge_mass "158.2380"
xref: delta_composition "H(18) C(9) O(2)"
xref: username_of_poster "rkupfer"
xref: group_of_poster "users"
xref: date_time_posted "2005-08-10 20:52:36"
xref: date_time_modified "2011-07-18 11:28:34"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "H"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "K"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:337
name: Methylamine
def: "Michael addition with methylamine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=337]
xref: record_id "337"
xref: delta_mono_mass "13.031634"
xref: delta_avge_mass "13.0418"
xref: delta_composition "H(3) C N O(-1)"
xref: username_of_poster "zhulx"
xref: group_of_poster "users"
xref: date_time_posted "2005-08-12 21:55:51"
xref: date_time_modified "2006-10-14 10:02:51"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Artefact"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:340
name: Bromo
def: "Bromination." [PMID:9033387, RESID:AA0174, RESID:AA0175, RESID:AA0176, RESID:AA0173, RESID:AA0180, RESID:AA0179, FindMod:BROM, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=340]
xref: record_id "340"
xref: delta_mono_mass "77.910511"
xref: delta_avge_mass "78.8961"
xref: delta_composition "H(-1) Br"
xref: username_of_poster "gerribe"
xref: group_of_poster "users"
xref: date_time_posted "2005-09-06 08:31:51"
xref: date_time_modified "2011-11-21 12:07:51"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "W"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "H"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "F"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Post-translational"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "Y"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Artefact"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:342
name: Amino
def: "Tyrosine oxidation to 2-aminotyrosine." [PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=342]
xref: record_id "342"
xref: delta_mono_mass "15.010899"
xref: delta_avge_mass "15.0146"
xref: delta_composition "H N"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-09-10 21:18:23"
xref: date_time_modified "2006-10-14 10:39:53"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Y"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:343
name: Argbiotinhydrazide
def: "Oxidized Arginine biotinylated with biotin hydrazide." [PMID:15828771, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=343]
xref: record_id "343"
xref: delta_mono_mass "199.066699"
xref: delta_avge_mass "199.2700"
xref: delta_composition "H(13) C(9) N O(2) S"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-09-10 22:36:58"
xref: date_time_modified "2006-11-14 12:10:30"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:344
name: Arg->GluSA
def: "Arginine oxidation to glutamic semialdehyde." [PMID:9252331, PMID:1680314, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=344]
synonym: "Arginine oxidation to gamma-glutamyl semialdehyde" []
xref: record_id "344"
xref: delta_mono_mass "-43.053433"
xref: delta_avge_mass "-43.0711"
xref: delta_composition "H(-5) C(-1) N(-3) O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-09-10 22:38:24"
xref: date_time_modified "2006-11-16 15:25:28"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:345
name: Trioxidation
def: "Cysteine oxidation to cysteic acid." [PMID:9252331, PMID:14678012, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=345]
xref: record_id "345"
xref: delta_mono_mass "47.984744"
xref: delta_avge_mass "47.9982"
xref: delta_composition "O(3)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-09-10 22:39:38"
xref: date_time_modified "2011-11-25 11:17:41"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "W"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:348
name: His->Asn
def: "His->Asn substitution." [PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=348]
synonym: "histidine oxidation to aspargine" []
xref: record_id "348"
xref: delta_mono_mass "-23.015984"
xref: delta_avge_mass "-23.0366"
xref: delta_composition "H(-1) C(-2) N(-1) O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-09-10 22:43:27"
xref: date_time_modified "2011-06-23 12:00:22"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "H"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
xref: spec_1_misc_notes "Could also be classed as chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:349
name: His->Asp
def: "His->Asp substitution." [PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=349]
synonym: "histidine oxidation to aspartic acid" []
xref: record_id "349"
xref: delta_mono_mass "-22.031969"
xref: delta_avge_mass "-22.0519"
xref: delta_composition "H(-2) C(-2) N(-2) O(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-09-10 22:44:32"
xref: date_time_modified "2011-06-23 12:00:45"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "H"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
xref: spec_1_misc_notes "Could also be classed as chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:350
name: Trp->Hydroxykynurenin
def: "Tryptophan oxidation to hydroxykynurenin." [URL:http\://www.lbqp.unb.br/bioq/htm/aulas2D/deg_aa_ile_leu_trp.htm?reload_coolmenus, PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=350]
xref: record_id "350"
xref: delta_mono_mass "19.989829"
xref: delta_avge_mass "19.9881"
xref: delta_composition "C(-1) O(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-09-10 22:47:20"
xref: date_time_modified "2006-11-14 17:40:45"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "W"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:351
name: Trp->Kynurenin
def: "Tryptophan oxidation to kynurenin." [PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=351]
xref: record_id "351"
xref: delta_mono_mass "3.994915"
xref: delta_avge_mass "3.9887"
xref: delta_composition "C(-1) O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-09-10 22:48:33"
xref: date_time_modified "2006-10-14 09:39:53"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "W"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:352
name: Lys->Allysine
def: "Lysine oxidation to aminoadipic semialdehyde." [RESID:AA0121, FindMod:ALLYS, PMID:9252331, PMID:11120890, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=352]
xref: record_id "352"
xref: delta_mono_mass "-1.031634"
xref: delta_avge_mass "-1.0311"
xref: delta_composition "H(-3) N(-1) O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-09-10 22:49:59"
xref: date_time_modified "2006-10-13 18:27:28"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:353
name: Lysbiotinhydrazide
def: "Oxidized Lysine biotinylated with biotin hydrazide." [URL:http\://www.piercenet.com/Proteomics/browse.cfm?fldID=84EBE112-F871-4CA5-807F-47327153CFCB, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=353]
xref: record_id "353"
xref: delta_mono_mass "241.088497"
xref: delta_avge_mass "241.3100"
xref: delta_composition "H(15) C(10) N(3) O(2) S"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-09-10 22:51:13"
xref: date_time_modified "2006-11-14 12:12:01"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:354
name: Nitro
def: "Oxidation to nitro." [PMID:8839040, PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=354]
xref: record_id "354"
xref: delta_mono_mass "44.985078"
xref: delta_avge_mass "44.9976"
xref: delta_composition "H(-1) N O(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-09-10 22:52:38"
xref: date_time_modified "2006-10-16 10:02:15"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "W"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "Y"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:357
name: probiotinhydrazide
def: "Oxidized proline biotinylated with biotin hydrazide." [URL:http\://www.piercenet.com/Proteomics/browse.cfm?fldID=84EBE112-F871-4CA5-807F-47327153CFCB, PMID:15174056, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=357]
xref: record_id "357"
xref: delta_mono_mass "258.115047"
xref: delta_avge_mass "258.3405"
xref: delta_composition "H(18) C(10) N(4) O(2) S"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-09-10 22:56:20"
xref: date_time_modified "2006-11-14 12:12:19"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "P"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:359
name: Pro->pyro-Glu
def: "Proline oxidation to pyroglutamic acid." [PMID:9252331, PMID:10717661, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=359]
xref: record_id "359"
xref: delta_mono_mass "13.979265"
xref: delta_avge_mass "13.9835"
xref: delta_composition "H(-2) O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-09-10 22:58:42"
xref: date_time_modified "2006-10-14 10:03:34"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "P"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:360
name: Pro->Pyrrolidinone
def: "Proline oxidation to pyrrolidinone." [PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=360]
xref: record_id "360"
xref: delta_mono_mass "-30.010565"
xref: delta_avge_mass "-30.0260"
xref: delta_composition "H(-2) C(-1) O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-09-10 23:00:19"
xref: date_time_modified "2006-10-13 15:37:42"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "P"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:361
name: Thrbiotinhydrazide
def: "Oxidized Threonine biotinylated with biotin hydrazide." [URL:http\://www.piercenet.com/Proteomics/browse.cfm?fldID=84EBE112-F871-4CA5-807F-47327153CFCB, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=361]
xref: record_id "361"
xref: delta_mono_mass "240.104482"
xref: delta_avge_mass "240.3252"
xref: delta_composition "H(16) C(10) N(4) O S"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-09-10 23:01:28"
xref: date_time_modified "2006-11-14 12:12:13"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "T"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:362
name: Diisopropylphosphate
def: "O-Diisopropylphosphorylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=362]
comment: A selective label for the active site serine of the serine esterase/protease family. It has also been shown to label tyrosine in serum albumin.
xref: record_id "362"
xref: delta_mono_mass "164.060231"
xref: delta_avge_mass "164.1394"
xref: delta_composition "H(13) C(6) O(3) P"
xref: username_of_poster "lmschopfer"
xref: group_of_poster "users"
xref: date_time_posted "2005-09-14 18:05:04"
xref: date_time_modified "2011-12-05 16:14:23"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "K"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Chemical derivative"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "N-term"
xref: spec_5_position "Any N-term"
xref: spec_5_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:363
name: Isopropylphospho
def: "O-Isopropylphosphorylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=363]
comment: Created by auto-catalytic dealkylation of the O-Diisopropylphosphate adduct.
xref: record_id "363"
xref: delta_mono_mass "122.013281"
xref: delta_avge_mass "122.0596"
xref: delta_composition "H(7) C(3) O(3) P"
xref: username_of_poster "lmschopfer"
xref: group_of_poster "users"
xref: date_time_posted "2005-09-14 18:08:20"
xref: date_time_modified "2007-01-15 15:25:45"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:364
name: ICPL:13C(6)
def: "Bruker Daltonics SERVA-ICPL(TM) quantification chemistry, heavy form." [URL:http\://www.bdal.de/life-science-tools/care-consumables-more/icpl-kit.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=364]
comment: Attention: As the digest is typically applied AFTER ICPL_light/heavy labeling, only ProteinN-term labeling and Lys-specific labeling is applied.
xref: record_id "364"
xref: delta_mono_mass "111.041593"
xref: delta_avge_mass "111.0500"
xref: delta_composition "H(3) 13C(6) N O"
xref: username_of_poster "suckau"
xref: group_of_poster "users"
xref: date_time_posted "2005-09-19 12:45:52"
xref: date_time_modified "2008-09-03 15:27:07"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "0"
xref: spec_2_site "N-term"
xref: spec_2_position "Protein N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_2_misc_notes "Use when labelling pre-digest"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N-term"
xref: spec_3_position "Any N-term"
xref: spec_3_classification "Isotopic label"
xref: spec_3_misc_notes "Use when labelling post-digest"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:365
name: ICPL
def: "Bruker Daltonics SERVA-ICPL(TM) quantification chemistry, light form." [URL:http\://www.bdal.de/life-science-tools/care-consumables-more/icpl-kit.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=365]
comment: Attention: As the digest is typically applied AFTER ICPL_light/heavy labeling, only ProteinN-term labeling and Lys-specific labeling is applied.
xref: record_id "365"
xref: delta_mono_mass "105.021464"
xref: delta_avge_mass "105.0941"
xref: delta_composition "H(3) C(6) N O"
xref: username_of_poster "suckau"
xref: group_of_poster "users"
xref: date_time_posted "2005-09-19 13:00:14"
xref: date_time_modified "2008-09-03 15:26:36"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "0"
xref: spec_2_site "N-term"
xref: spec_2_position "Protein N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_2_misc_notes "Use when labelling pre-digest"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N-term"
xref: spec_3_position "Any N-term"
xref: spec_3_classification "Isotopic label"
xref: spec_3_misc_notes "Use when labelling post-digest"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:366
name: Deamidated:18O(1)
def: "Deamidation in presence of O18." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=366]
comment: Observed.
xref: record_id "366"
xref: delta_mono_mass "2.988261"
xref: delta_avge_mass "2.9845"
xref: delta_composition "H(-1) N(-1) 18O"
xref: username_of_poster "gerribe"
xref: group_of_poster "users"
xref: date_time_posted "2005-09-22 15:30:16"
xref: date_time_modified "2006-10-14 09:35:33"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Q"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:368
name: Cys->Dha
def: "Dehydroalanine (from Cysteine)." [PMID:11212008, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=368]
xref: record_id "368"
xref: delta_mono_mass "-33.987721"
xref: delta_avge_mass "-34.0809"
xref: delta_composition "H(-2) S(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-02 17:31:11"
xref: date_time_modified "2006-10-13 15:27:46"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:369
name: Pro->Pyrrolidone
def: "Pyrrolidone from Proline." [PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=369]
xref: record_id "369"
xref: delta_mono_mass "-27.994915"
xref: delta_avge_mass "-28.0101"
xref: delta_composition "C(-1) O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-02 17:39:05"
xref: date_time_modified "2006-11-14 11:12:17"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "P"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:371
name: HMVK
def: "Michael addition of hydroxymethylvinyl ketone to cysteine." [PMID:11743741, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=371]
synonym: "hydroxymethylvinyl ketone" []
xref: record_id "371"
xref: delta_mono_mass "86.036779"
xref: delta_avge_mass "86.0892"
xref: delta_composition "H(6) C(4) O(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-03 15:59:33"
xref: date_time_modified "2006-10-16 12:15:35"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:372
name: Arg->Orn
def: "Ornithine from Arginine." [PMID:15489230, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=372]
xref: record_id "372"
xref: delta_mono_mass "-42.021798"
xref: delta_avge_mass "-42.0400"
xref: delta_composition "H(-2) C(-1) N(-2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-05 17:55:25"
xref: date_time_modified "2006-10-13 15:26:33"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:374
name: Dehydro
def: "Half of a disulfide bridge." [RESID:AA0025, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=374]
xref: record_id "374"
xref: delta_mono_mass "-1.007825"
xref: delta_avge_mass "-1.0079"
xref: delta_composition "H(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-06 20:57:01"
xref: date_time_modified "2006-10-13 18:28:17"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Multiple"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:375
name: Diphthamide
def: "Diphthamide." [RESID:AA0040, FindMod:DIPH, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=375]
xref: record_id "375"
xref: delta_mono_mass "143.118438"
xref: delta_avge_mass "143.2068"
xref: delta_composition "H(15) C(7) N(2) O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-06 23:21:29"
xref: date_time_modified "2006-10-16 13:43:13"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "H"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:376
name: Hydroxyfarnesyl
def: "Hydroxyfarnesyl." [RESID:AA0103, FindMod:FAR0, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=376]
xref: record_id "376"
xref: delta_mono_mass "220.182715"
xref: delta_avge_mass "220.3505"
xref: delta_composition "H(24) C(15) O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-07 20:36:20"
xref: date_time_modified "2006-10-16 15:20:11"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:377
name: Diacylglycerol
def: "Diacylglycerol." [RESID:AA0107, FindMod:DIAC, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=377]
xref: record_id "377"
xref: delta_mono_mass "576.511761"
xref: delta_avge_mass "576.9334"
xref: delta_composition "H(68) C(37) O(4)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-07 20:41:21"
xref: date_time_modified "2006-10-16 17:05:40"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:378
name: Carboxyethyl
def: "Carboxyethyl." [RESID:AA0115, FindMod:CETH, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=378]
xref: record_id "378"
xref: delta_mono_mass "72.021129"
xref: delta_avge_mass "72.0627"
xref: delta_composition "H(4) C(3) O(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-07 22:18:20"
xref: date_time_modified "2006-10-16 10:36:16"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:379
name: Hypusine
def: "Hypusine." [RESID:AA0116, FindMod:HYPU, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=379]
xref: record_id "379"
xref: delta_mono_mass "87.068414"
xref: delta_avge_mass "87.1204"
xref: delta_composition "H(9) C(4) N O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-07 22:20:53"
xref: date_time_modified "2006-10-16 12:35:24"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:380
name: Retinylidene
def: "Retinal." [RESID:AA0120, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=380]
xref: record_id "380"
xref: delta_mono_mass "266.203451"
xref: delta_avge_mass "266.4204"
xref: delta_composition "H(26) C(20)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-07 22:27:27"
xref: date_time_modified "2006-10-16 15:47:14"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:381
name: Lys->AminoadipicAcid
def: "Alpha-amino adipic acid." [RESID:AA0122, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=381]
xref: record_id "381"
xref: delta_mono_mass "14.963280"
xref: delta_avge_mass "14.9683"
xref: delta_composition "H(-3) N(-1) O(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-11 17:41:37"
xref: date_time_modified "2006-10-14 10:33:11"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:382
name: Cys->PyruvicAcid
def: "Pyruvic acid from N-term cys." [RESID:AA0127, FindMod:PYRUC, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=382]
xref: record_id "382"
xref: delta_mono_mass "-33.003705"
xref: delta_avge_mass "-33.0961"
xref: delta_composition "H(-3) N(-1) O S(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-11 17:48:42"
xref: date_time_modified "2006-10-13 16:42:55"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Protein N-term"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:385
name: Ammonia-loss
def: "Loss of ammonia." [RESID:AA0127, FindMod:PYRUS, RESID:AA0129, FindMod:OXOB, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=385]
synonym: "oxobutanoic acid from N term Thr pyruvic acid from N-term ser" []
xref: record_id "385"
xref: delta_mono_mass "-17.026549"
xref: delta_avge_mass "-17.0305"
xref: delta_composition "H(-3) N(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-11 18:00:01"
xref: date_time_modified "2007-07-15 20:11:01"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "T"
xref: spec_1_position "Protein N-term"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "S"
xref: spec_2_position "Protein N-term"
xref: spec_2_classification "Post-translational"
xref: spec_3_group "3"
xref: spec_3_hidden "0"
xref: spec_3_site "C"
xref: spec_3_position "Any N-term"
xref: spec_3_classification "Artefact"
xref: spec_3_misc_notes "Pyro-carbamidomethyl as a delta from Carbamidomethyl-Cys"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "N"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Chemical derivative"
xref: spec_4_misc_notes "N-Succinimide"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:387
name: Phycocyanobilin
def: "Phycocyanobilin." [RESID:AA0258, RESID:AA0131, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=387]
comment: Phycocyanobilin and phycobiliviolin have different structures but the same empirical formula.
synonym: "phycobiliviolin" []
xref: record_id "387"
xref: delta_mono_mass "586.279135"
xref: delta_avge_mass "586.6780"
xref: delta_composition "H(38) C(33) N(4) O(6)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-11 18:06:19"
xref: date_time_modified "2006-10-16 17:07:44"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:388
name: Phycoerythrobilin
def: "Phycoerythrobilin." [RESID:AA0132, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=388]
xref: record_id "388"
xref: delta_mono_mass "588.294785"
xref: delta_avge_mass "588.6939"
xref: delta_composition "H(40) C(33) N(4) O(6)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-11 18:08:38"
xref: date_time_modified "2006-10-16 17:08:02"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:389
name: Phytochromobilin
def: "Phytochromobilin." [RESID:AA0133, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=389]
xref: record_id "389"
xref: delta_mono_mass "584.263485"
xref: delta_avge_mass "584.6621"
xref: delta_composition "H(36) C(33) N(4) O(6)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-11 18:23:58"
xref: date_time_modified "2006-10-16 17:07:22"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:390
name: Heme
def: "Heme." [RESID:AA0329, RESID:AA0135, RESID:AA0276, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=390]
xref: record_id "390"
xref: delta_mono_mass "616.177295"
xref: delta_avge_mass "616.4873"
xref: delta_composition "H(32) C(34) N(4) O(4) Fe"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-11 18:27:20"
xref: date_time_modified "2006-10-16 17:10:28"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "H"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:391
name: Molybdopterin
def: "Molybdopterin." [RESID:AA0142, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=391]
xref: record_id "391"
xref: delta_mono_mass "521.884073"
xref: delta_avge_mass "520.2668"
xref: delta_composition "H(11) C(10) N(5) O(8) P S(2) Mo"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-11 18:46:19"
xref: date_time_modified "2006-10-16 17:02:25"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:392
name: Quinone
def: "Quinone." [RESID:AA0147, RESID:AA0148, FindMod:TOPA, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=392]
xref: record_id "392"
xref: delta_mono_mass "29.974179"
xref: delta_avge_mass "29.9829"
xref: delta_composition "H(-2) O(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-11 18:56:28"
xref: date_time_modified "2006-10-15 18:03:47"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Y"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "W"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:393
name: Glucosylgalactosyl
def: "Glucosylgalactosyl hydroxylysine." [RESID:AA0153, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=393]
xref: record_id "393"
xref: delta_mono_mass "340.100562"
xref: delta_avge_mass "340.2806"
xref: delta_composition "O Hex(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-11 19:19:13"
xref: date_time_modified "2007-12-04 08:55:56"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "O-linked glycosylation"
xref: spec_1_neutral_loss_325_mono_mass "324.105647"
xref: spec_1_neutral_loss_325_avge_mass "324.2812"
xref: spec_1_neutral_loss_325_flag "false"
xref: spec_1_neutral_loss_325_composition "Hex(2)"
xref: spec_1_neutral_loss_163_mono_mass "162.052823"
xref: spec_1_neutral_loss_163_avge_mass "162.1406"
xref: spec_1_neutral_loss_163_flag "false"
xref: spec_1_neutral_loss_163_composition "Hex"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:394
name: GPIanchor
def: "Glycosylphosphatidylinositol." [RESID:AA0158, RESID:AA0159, RESID:AA0160, RESID:AA0161, RESID:AA0162, RESID:AA0163, RESID:AA0164, RESID:AA0165, RESID:AA0166, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=394]
xref: record_id "394"
xref: delta_mono_mass "123.008530"
xref: delta_avge_mass "123.0477"
xref: delta_composition "H(6) C(2) N O(3) P"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-11 19:31:10"
xref: date_time_modified "2006-11-14 11:13:52"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C-term"
xref: spec_1_position "Protein C-term"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:395
name: PhosphoribosyldephosphoCoA
def: "Phosphoribosyl dephospho-coenzyme A." [RESID:AA0167, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=395]
xref: record_id "395"
xref: delta_mono_mass "881.146904"
xref: delta_avge_mass "881.6335"
xref: delta_composition "H(42) C(26) N(7) O(19) P(3) S"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-11 19:42:56"
xref: date_time_modified "2006-10-16 17:19:42"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:396
name: GlycerylPE
def: "Glycerylphosphorylethanolamine." [RESID:AA0170, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=396]
xref: record_id "396"
xref: delta_mono_mass "197.045310"
xref: delta_avge_mass "197.1262"
xref: delta_composition "H(12) C(5) N O(5) P"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-11 19:50:17"
xref: date_time_modified "2006-10-16 15:08:39"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "E"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:397
name: Triiodothyronine
def: "Triiodo." [RESID:AA0177, FindMod:THRN, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=397]
xref: record_id "397"
xref: delta_mono_mass "469.716159"
xref: delta_avge_mass "469.7850"
xref: delta_composition "H C(6) O I(3)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-11 20:08:28"
xref: date_time_modified "2006-10-16 16:59:19"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Y"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:398
name: Thyroxine
def: "Tetraiodo." [RESID:AA0178, FindMod:THRX, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=398]
xref: record_id "398"
xref: delta_mono_mass "595.612807"
xref: delta_avge_mass "595.6815"
xref: delta_composition "C(6) O I(4)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-11 20:10:14"
xref: date_time_modified "2006-10-16 17:08:51"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Y"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:400
name: Tyr->Dha
def: "Dehydroalanine (from Tyrosine)." [RESID:AA0181, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=400]
xref: record_id "400"
xref: delta_mono_mass "-94.041865"
xref: delta_avge_mass "-94.1112"
xref: delta_composition "H(-6) C(-6) O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-11 20:17:48"
xref: date_time_modified "2006-10-13 15:02:50"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Y"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:401
name: Didehydro
def: "2-amino-3-oxo-butanoic_acid." [RESID:AA0183, RESID:AA0185, PMID:9252331, RESID:AA0365, FindMod:OXOAS, FindMod:DHY, PMID:15705169, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=401]
synonym: "oxoalanine" []
xref: record_id "401"
xref: delta_mono_mass "-2.015650"
xref: delta_avge_mass "-2.0159"
xref: delta_composition "H(-2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-11 20:23:58"
xref: date_time_modified "2008-07-30 12:01:47"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Y"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "S"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
xref: spec_2_misc_notes "oxoalanine formylglycine"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "T"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "K"
xref: spec_4_position "Any C-term"
xref: spec_4_classification "Artefact"
xref: spec_4_misc_notes "Lactone formation from C-terminal hydroxylysine"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:402
name: Cys->Oxoalanine
def: "Oxoalanine." [RESID:AA0185, FindMod:OXOAC, PMID:18722427, PMID:17450134, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=402]
synonym: "formylglycine" []
xref: record_id "402"
xref: delta_mono_mass "-17.992806"
xref: delta_avge_mass "-18.0815"
xref: delta_composition "H(-2) O S(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-11 20:29:10"
xref: date_time_modified "2009-03-13 16:04:03"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:403
name: Ser->LacticAcid
def: "Lactic acid from N-term Ser." [RESID:AA0186, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=403]
xref: record_id "403"
xref: delta_mono_mass "-15.010899"
xref: delta_avge_mass "-15.0146"
xref: delta_composition "H(-1) N(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-11 20:34:16"
xref: date_time_modified "2006-10-13 17:18:52"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Protein N-term"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:405
name: Phosphoadenosine
def: "AMP binding site." [RESID:AA0371, RESID:AA0227, RESID:AA0203, RESID:AA0267, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=405]
xref: record_id "405"
xref: delta_mono_mass "329.052520"
xref: delta_avge_mass "329.2059"
xref: delta_composition "H(12) C(10) N(5) O(6) P"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-11 21:34:01"
xref: date_time_modified "2006-10-16 15:53:49"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Y"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "T"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Post-translational"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "H"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:407
name: Hydroxycinnamyl
def: "Hydroxycinnamyl." [RESID:AA0207, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=407]
xref: record_id "407"
xref: delta_mono_mass "146.036779"
xref: delta_avge_mass "146.1427"
xref: delta_composition "H(6) C(9) O(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-11 21:40:43"
xref: date_time_modified "2006-10-16 14:02:07"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:408
name: Glycosyl
def: "Glycosyl-L-hydroxyproline." [RESID:AA0212, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=408]
xref: record_id "408"
xref: delta_mono_mass "148.037173"
xref: delta_avge_mass "148.1140"
xref: delta_composition "H(8) C(5) O(5)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-11 21:57:16"
xref: date_time_modified "2006-10-16 14:03:02"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "P"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "O-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:409
name: FMNH
def: "Flavin mononucleotide." [RESID:AA0353, RESID:AA0220, RESID:AA0352, FindMod:FMNH, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=409]
xref: record_id "409"
xref: delta_mono_mass "454.088965"
xref: delta_avge_mass "454.3279"
xref: delta_composition "H(19) C(17) N(4) O(9) P"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-11 22:09:45"
xref: date_time_modified "2006-10-16 16:57:46"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "H"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:410
name: Archaeol
def: "S-diphytanylglycerol diether." [RESID:AA0223, FindMod:ARCH, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=410]
xref: record_id "410"
xref: delta_mono_mass "634.662782"
xref: delta_avge_mass "635.1417"
xref: delta_composition "H(86) C(43) O(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-11 22:15:37"
xref: date_time_modified "2006-10-16 17:10:59"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:411
name: Phenylisocyanate
def: "Phenyl isocyanate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=411]
xref: record_id "411"
xref: delta_mono_mass "119.037114"
xref: delta_avge_mass "119.1207"
xref: delta_composition "H(5) C(7) N O"
xref: username_of_poster "TING"
xref: group_of_poster "users"
xref: date_time_posted "2005-10-14 21:13:16"
xref: date_time_modified "2006-10-16 12:48:08"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N-term"
xref: spec_1_position "Any N-term"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:412
name: Phenylisocyanate:2H(5)
def: "D5-phenyl isocyanate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=412]
xref: record_id "412"
xref: delta_mono_mass "124.068498"
xref: delta_avge_mass "124.1515"
xref: delta_composition "2H(5) C(7) N O"
xref: username_of_poster "TING"
xref: group_of_poster "users"
xref: date_time_posted "2005-10-14 21:16:11"
xref: date_time_modified "2006-10-16 13:35:26"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N-term"
xref: spec_1_position "Any N-term"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:413
name: Phosphoguanosine
def: "Phospho-guanosine." [RESID:AA0325, RESID:AA0228, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=413]
xref: record_id "413"
xref: delta_mono_mass "345.047435"
xref: delta_avge_mass "345.2053"
xref: delta_composition "H(12) C(10) N(5) O(7) P"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 15:50:03"
xref: date_time_modified "2006-10-16 16:01:42"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "H"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:414
name: Hydroxymethyl
def: "Hydroxymethyl." [RESID:AA0236, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=414]
xref: record_id "414"
xref: delta_mono_mass "30.010565"
xref: delta_avge_mass "30.0260"
xref: delta_composition "H(2) C O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 16:12:56"
xref: date_time_modified "2006-10-15 18:04:18"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:415
name: MolybdopterinGD+Delta:S(-1)Se(1)
def: "L-selenocysteinyl molybdenum bis(molybdopterin guanine dinucleotide)." [RESID:AA0248, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=415]
xref: record_id "415"
xref: delta_mono_mass "1620.930224"
xref: delta_avge_mass "1618.9096"
xref: delta_composition "H(47) C(40) N(20) O(26) P(4) S(3) Se Mo"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 16:27:56"
xref: date_time_modified "2006-10-17 11:44:58"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:416
name: Dipyrrolylmethanemethyl
def: "Dipyrrolylmethanemethyl." [RESID:AA0252, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=416]
xref: record_id "416"
xref: delta_mono_mass "418.137616"
xref: delta_avge_mass "418.3973"
xref: delta_composition "H(22) C(20) N(2) O(8)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 16:33:24"
xref: date_time_modified "2006-11-14 10:37:01"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:417
name: PhosphoUridine
def: "Uridine phosphodiester." [RESID:AA0256, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=417]
xref: record_id "417"
xref: delta_mono_mass "306.025302"
xref: delta_avge_mass "306.1660"
xref: delta_composition "H(11) C(9) N(2) O(8) P"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 16:38:18"
xref: date_time_modified "2006-10-16 15:52:11"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Y"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "H"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:419
name: Glycerophospho
def: "Glycerophospho." [RESID:AA0264, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=419]
xref: record_id "419"
xref: delta_mono_mass "154.003110"
xref: delta_avge_mass "154.0584"
xref: delta_composition "H(7) C(3) O(5) P"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 17:02:51"
xref: date_time_modified "2006-10-16 14:03:40"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:420
name: Carboxy->Thiocarboxy
def: "Thiocarboxylic acid." [FindMod:THIOG, RESID:AA0265, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=420]
xref: record_id "420"
xref: delta_mono_mass "15.977156"
xref: delta_avge_mass "16.0656"
xref: delta_composition "O(-1) S"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 17:08:53"
xref: date_time_modified "2006-10-14 10:59:20"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "G"
xref: spec_1_position "Protein C-term"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:421
name: Sulfide
def: "Persulfide." [RESID:AA0269, FindMod:CYSP, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=421]
xref: record_id "421"
xref: delta_mono_mass "31.972071"
xref: delta_avge_mass "32.0650"
xref: delta_composition "S"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 17:22:45"
xref: date_time_modified "2010-02-14 11:06:23"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "D"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
xref: spec_2_misc_notes "beta-thiolation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:422
name: PyruvicAcidIminyl
def: "N-pyruvic acid 2-iminyl." [RESID:AA0287, RESID:AA0274, RESID:AA0275, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=422]
xref: record_id "422"
xref: delta_mono_mass "70.005479"
xref: delta_avge_mass "70.0468"
xref: delta_composition "H(2) C(3) O(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 17:30:48"
xref: date_time_modified "2006-10-16 10:35:08"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Protein N-term"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "V"
xref: spec_2_position "Protein N-term"
xref: spec_2_classification "Post-translational"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "K"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:423
name: Delta:Se(1)
def: "Selenyl." [RESID:AA0277, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=423]
xref: record_id "423"
xref: delta_mono_mass "79.916520"
xref: delta_avge_mass "78.9600"
xref: delta_composition "Se"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 17:49:48"
xref: date_time_modified "2006-10-16 11:14:44"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:424
name: MolybdopterinGD
def: "Molybdenum bis(molybdopterin guanine dinucleotide)." [RESID:AA0281, RESID:AA0375, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=424]
xref: record_id "424"
xref: delta_mono_mass "1572.985775"
xref: delta_avge_mass "1572.0146"
xref: delta_composition "H(47) C(40) N(20) O(26) P(4) S(4) Mo"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 17:53:48"
xref: date_time_modified "2006-10-17 11:44:28"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "D"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:425
name: Dioxidation
def: "Dihydroxy." [PMID:12686488, RESID:AA0262, FindMod:CSIA, FindMod:MSONE, FindMod:DIHYDR, PMID:9252331, RESID:AA0251, RESID:AA0370, RESID:AA0282, RESID:AA0369, RESID:AA0263, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=425]
xref: record_id "425"
xref: delta_mono_mass "31.989829"
xref: delta_avge_mass "31.9988"
xref: delta_composition "O(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 17:59:33"
xref: date_time_modified "2006-10-15 18:19:52"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "P"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "R"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "K"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Post-translational"
xref: spec_4_group "4"
xref: spec_4_hidden "0"
xref: spec_4_site "M"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Post-translational"
xref: spec_4_misc_notes "Sulphone"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "F"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Chemical derivative"
xref: spec_5_misc_notes "phenylalanine oxidation to dihydroxyphenylalanine"
xref: spec_6_group "6"
xref: spec_6_hidden "1"
xref: spec_6_site "W"
xref: spec_6_position "Anywhere"
xref: spec_6_classification "Chemical derivative"
xref: spec_6_misc_notes "tryptophan oxidation to formylkynurenin"
xref: spec_7_group "7"
xref: spec_7_hidden "1"
xref: spec_7_site "Y"
xref: spec_7_position "Anywhere"
xref: spec_7_classification "Post-translational"
xref: spec_7_misc_notes "trihydroxyphenylalanine"
xref: spec_8_group "8"
xref: spec_8_hidden "1"
xref: spec_8_site "C"
xref: spec_8_position "Anywhere"
xref: spec_8_classification "Post-translational"
xref: spec_8_misc_notes "sulfinic acid"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:426
name: Octanoyl
def: "Octanoyl." [RESID:AA0386, RESID:AA0290, FindMod:OCTA, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=426]
xref: record_id "426"
xref: delta_mono_mass "126.104465"
xref: delta_avge_mass "126.1962"
xref: delta_composition "H(14) C(8) O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 18:04:46"
xref: date_time_modified "2006-10-16 13:38:44"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:428
name: PhosphoHexNAc
def: "N-acetylglucosamine-1-phosphoryl." [RESID:AA0296, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=428]
xref: record_id "428"
xref: delta_mono_mass "283.045704"
xref: delta_avge_mass "283.1724"
xref: delta_composition "H O(3) P HexNAc"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 18:15:16"
xref: date_time_modified "2010-11-05 17:03:09"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other glycosylation"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "O-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:429
name: PhosphoHex
def: "Phosphoglycosyl-D-mannose-1-phosphoryl." [RESID:AA0297, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=429]
xref: record_id "429"
xref: delta_mono_mass "242.019154"
xref: delta_avge_mass "242.1205"
xref: delta_composition "H O(3) P Hex"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 18:18:51"
xref: date_time_modified "2006-10-16 15:48:55"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:431
name: Palmitoleyl
def: "Palmitoleyl." [RESID:AA0308, FindMod:PALE, PMID:17141155, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=431]
xref: record_id "431"
xref: delta_mono_mass "236.214016"
xref: delta_avge_mass "236.3929"
xref: delta_composition "H(28) C(16) O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 19:57:30"
xref: date_time_modified "2009-06-21 21:18:50"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "S"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "T"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Pre-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:432
name: Cholesterol
def: "Cholesterol ester." [RESID:AA0309, FindMod:CHOL, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=432]
xref: record_id "432"
xref: delta_mono_mass "368.344302"
xref: delta_avge_mass "368.6383"
xref: delta_composition "H(44) C(27)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 20:00:10"
xref: date_time_modified "2006-10-16 16:36:21"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C-term"
xref: spec_1_position "Protein C-term"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:433
name: Didehydroretinylidene
def: "3,4-didehydroretinylidene." [RESID:AA0312, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=433]
xref: record_id "433"
xref: delta_mono_mass "264.187801"
xref: delta_avge_mass "264.4046"
xref: delta_composition "H(24) C(20)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 20:05:19"
xref: date_time_modified "2006-10-16 15:46:50"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:434
name: CHDH
def: "Cis-14-hydroxy-10,13-dioxo-7-heptadecenoic ester." [RESID:AA0316, FindMod:CHDH, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=434]
xref: record_id "434"
xref: delta_mono_mass "294.183109"
xref: delta_avge_mass "294.3859"
xref: delta_composition "H(26) C(17) O(4)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 20:08:49"
xref: date_time_modified "2006-10-16 15:49:28"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "D"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:435
name: Methylpyrroline
def: "4-methyl-delta-1-pyrroline-5-carboxyl." [RESID:AA0321, FindMod:PYRK, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=435]
xref: record_id "435"
xref: delta_mono_mass "109.052764"
xref: delta_avge_mass "109.1259"
xref: delta_composition "H(7) C(6) N O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 20:21:00"
xref: date_time_modified "2006-10-16 13:37:33"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:436
name: Hydroxyheme
def: "Hydroxyheme." [RESID:AA0324, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=436]
xref: record_id "436"
xref: delta_mono_mass "614.161645"
xref: delta_avge_mass "614.4714"
xref: delta_composition "H(30) C(34) N(4) O(4) Fe"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 20:29:16"
xref: date_time_modified "2006-10-16 17:10:10"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "E"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:437
name: MicrocinC7
def: "(3-aminopropyl)(L-aspartyl-1-amino)phosphoryl-5-adenosine." [RESID:AA0328, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=437]
xref: record_id "437"
xref: delta_mono_mass "386.110369"
xref: delta_avge_mass "386.3003"
xref: delta_composition "H(19) C(13) N(6) O(6) P"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 20:36:37"
xref: date_time_modified "2006-10-16 16:40:21"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C-term"
xref: spec_1_position "Protein C-term"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:438
name: Cyano
def: "Cyano." [RESID:AA0333, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=438]
xref: record_id "438"
xref: delta_mono_mass "24.995249"
xref: delta_avge_mass "25.0095"
xref: delta_composition "H(-1) C N"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 20:42:40"
xref: date_time_modified "2006-10-14 19:43:48"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:439
name: Diironsubcluster
def: "Hydrogenase diiron subcluster." [RESID:AA0334, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=439]
xref: record_id "439"
xref: delta_mono_mass "342.786916"
xref: delta_avge_mass "342.8760"
xref: delta_composition "H(-1) C(5) N(2) O(5) S(2) Fe(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 20:46:03"
xref: date_time_modified "2006-10-16 16:01:22"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:440
name: Amidino
def: "Amidino." [RESID:AA0335, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=440]
xref: record_id "440"
xref: delta_mono_mass "42.021798"
xref: delta_avge_mass "42.0400"
xref: delta_composition "H(2) C N(2)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 20:49:10"
xref: date_time_modified "2006-10-15 19:58:03"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:442
name: FMN
def: "O3-(riboflavin phosphoryl)." [RESID:AA0350, RESID:AA0349, FindMod:FMN, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=442]
xref: record_id "442"
xref: delta_mono_mass "438.094051"
xref: delta_avge_mass "438.3285"
xref: delta_composition "H(19) C(17) N(4) O(8) P"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 21:11:32"
xref: date_time_modified "2006-10-16 16:47:27"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "T"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "S"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:443
name: FMNC
def: "S-(4a-FMN)." [RESID:AA0351, FindMod:FMNC, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=443]
xref: record_id "443"
xref: delta_mono_mass "456.104615"
xref: delta_avge_mass "456.3438"
xref: delta_composition "H(21) C(17) N(4) O(9) P"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 21:21:47"
xref: date_time_modified "2006-10-16 16:58:10"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:444
name: CuSMo
def: "Copper sulfido molybdopterin cytosine dinuncleotide." [RESID:AA0355, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=444]
xref: record_id "444"
xref: delta_mono_mass "922.834855"
xref: delta_avge_mass "922.0670"
xref: delta_composition "H(24) C(19) N(8) O(15) P(2) S(3) Cu Mo"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 21:34:38"
xref: date_time_modified "2006-10-16 17:20:14"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:445
name: Hydroxytrimethyl
def: "5-hydroxy-N6,N6,N6-trimethyl." [RESID:AA0359, FindMod:TRIMETK, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=445]
xref: record_id "445"
xref: delta_mono_mass "59.049690"
xref: delta_avge_mass "59.0871"
xref: delta_composition "H(7) C(3) O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 21:40:08"
xref: date_time_modified "2006-10-16 10:28:02"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:447
name: Deoxy
def: "Reduction." [RESID:AA0191, PMID:14235557, RESID:AA0373, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=447]
synonym: "Serine to Alanine Threonine to a-aminobutyrate" []
xref: record_id "447"
xref: delta_mono_mass "-15.994915"
xref: delta_avge_mass "-15.9994"
xref: delta_composition "O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 22:00:35"
xref: date_time_modified "2006-10-13 17:16:30"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "D"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "S"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_2_misc_notes "Beta elimination of O-glycosylation under alkaline conditions followed by reduction"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "T"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
xref: spec_3_misc_notes "Beta elimination of O-glycosylation under alkaline conditions followed by reduction"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:448
name: Microcin
def: "Microcin E492 siderophore ester from serine." [RESID:AA0374, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=448]
xref: record_id "448"
xref: delta_mono_mass "831.197041"
xref: delta_avge_mass "831.6871"
xref: delta_composition "H(37) C(36) N(3) O(20)"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 22:04:46"
xref: date_time_modified "2006-10-16 17:18:24"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C-term"
xref: spec_1_position "Protein C-term"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:449
name: Decanoyl
def: "Lipid." [RESID:AA0387, RESID:AA0385, FindMod:DECA, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=449]
xref: record_id "449"
xref: delta_mono_mass "154.135765"
xref: delta_avge_mass "154.2493"
xref: delta_composition "H(18) C(10) O"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2005-10-15 22:14:11"
xref: date_time_modified "2006-10-16 14:04:24"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:450
name: Glu
def: "Monoglutamyl." [PMID:12356754, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=450]
xref: record_id "450"
xref: delta_mono_mass "129.042593"
xref: delta_avge_mass "129.1140"
xref: delta_composition "H(7) C(5) N O(3)"
xref: username_of_poster "vcavett"
xref: group_of_poster "users"
xref: date_time_posted "2005-10-18 15:07:18"
xref: date_time_modified "2006-10-17 13:48:54"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C-term"
xref: spec_1_position "Protein C-term"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "E"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:451
name: GluGlu
def: "Diglutamyl." [PMID:12356754, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=451]
xref: record_id "451"
xref: delta_mono_mass "258.085186"
xref: delta_avge_mass "258.2280"
xref: delta_composition "H(14) C(10) N(2) O(6)"
xref: username_of_poster "vcavett"
xref: group_of_poster "users"
xref: date_time_posted "2005-10-18 15:17:59"
xref: date_time_modified "2006-10-17 13:49:07"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C-term"
xref: spec_1_position "Protein C-term"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "E"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:452
name: GluGluGlu
def: "Triglutamyl." [PMID:12356754, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=452]
xref: record_id "452"
xref: delta_mono_mass "387.127779"
xref: delta_avge_mass "387.3419"
xref: delta_composition "H(21) C(15) N(3) O(9)"
xref: username_of_poster "vcavett"
xref: group_of_poster "users"
xref: date_time_posted "2005-10-18 15:21:01"
xref: date_time_modified "2006-10-17 14:11:11"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C-term"
xref: spec_1_position "Protein C-term"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "E"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:453
name: GluGluGluGlu
def: "Tetraglutamyl." [PMID:12356754, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=453]
xref: record_id "453"
xref: delta_mono_mass "516.170373"
xref: delta_avge_mass "516.4559"
xref: delta_composition "H(28) C(20) N(4) O(12)"
xref: username_of_poster "vcavett"
xref: group_of_poster "users"
xref: date_time_posted "2005-10-18 15:22:24"
xref: date_time_modified "2006-10-17 14:16:56"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C-term"
xref: spec_1_position "Protein C-term"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "E"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:454
name: HexN
def: "Hexosamine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=454]
synonym: "Galactosamine Glucosamine" []
xref: record_id "454"
xref: delta_mono_mass "161.068808"
xref: delta_avge_mass "161.1558"
xref: delta_composition "H(11) C(6) N O(4)"
xref: username_of_poster "xyuan"
xref: group_of_poster "users"
xref: date_time_posted "2005-11-08 18:58:20"
xref: date_time_modified "2006-10-16 14:09:11"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Synth. pep. protect. gp."
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "N-linked glycosylation"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "T"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "O-linked glycosylation"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "W"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:455
name: Xlink:DMP-s
def: "One end of crosslink attached, one end free." [URL:http\://www.piercenet.com/files/0668ss5.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=455]
synonym: "Dimethyl pimelimidate" []
xref: record_id "455"
xref: delta_mono_mass "154.110613"
xref: delta_avge_mass "154.2096"
xref: delta_composition "H(14) C(8) N(2) O"
xref: username_of_poster "mariana"
xref: group_of_poster "users"
xref: date_time_posted "2005-11-08 20:09:24"
xref: date_time_modified "2006-10-17 13:39:17"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Protein N-term"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:456
name: Xlink:DMP
def: "Both ends of crosslink attached to same peptide." [URL:http\://www.piercenet.com/files/0668ss5.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=456]
synonym: "Dimethyl pimelimidate" []
xref: record_id "456"
xref: delta_mono_mass "122.084398"
xref: delta_avge_mass "122.1677"
xref: delta_composition "H(10) C(7) N(2)"
xref: username_of_poster "mariana"
xref: group_of_poster "users"
xref: date_time_posted "2005-11-08 20:15:20"
xref: date_time_modified "2006-10-17 13:38:09"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_1_misc_notes "Dimethyl pimelimidate, reaction with both ends"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Protein N-term"
xref: spec_2_classification "Chemical derivative"
xref: spec_2_misc_notes "Dimethyl pimelimidate, reaction with both ends"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:457
name: NDA
def: "Naphthalene-2,3-dicarboxaldehyde." [PMID:2081203, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=457]
comment: Fluorescent derivative.
xref: record_id "457"
xref: delta_mono_mass "175.042199"
xref: delta_avge_mass "175.1855"
xref: delta_composition "H(5) C(13) N"
xref: username_of_poster "Dekker"
xref: group_of_poster "users"
xref: date_time_posted "2005-11-11 11:03:32"
xref: date_time_modified "2006-10-17 13:41:04"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:464
name: SPITC:13C(6)
def: "4-sulfophenyl isothiocyanate (Heavy C13)." [PMID:16526082, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=464]
synonym: "N-terminal / lysine sulfonation" []
xref: record_id "464"
xref: delta_mono_mass "220.991213"
xref: delta_avge_mass "221.2054"
xref: delta_composition "H(5) C 13C(6) N O(3) S(2)"
xref: username_of_poster "apanchaud"
xref: group_of_poster "users"
xref: date_time_posted "2005-12-19 08:37:57"
xref: date_time_modified "2006-10-16 15:25:36"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:472
name: AEC-MAEC
def: "Aminoethylcysteine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=472]
comment: Modification procedure used for phosphopeptide mapping.
synonym: "beta-methylaminoethylcysteine" []
xref: record_id "472"
xref: delta_mono_mass "59.019355"
xref: delta_avge_mass "59.1334"
xref: delta_composition "H(5) C(2) N O(-1) S"
xref: username_of_poster "mpcusack"
xref: group_of_poster "users"
xref: date_time_posted "2006-01-20 00:46:08"
xref: date_time_modified "2007-09-26 22:43:16"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_1_misc_notes "pS gives aminoethylcysteine"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_2_misc_notes "pT gives beta-methylaminoethylcysteine"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:476
name: TMAB
def: "4-trimethyllammoniumbutyryl-." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=476]
xref: record_id "476"
xref: delta_mono_mass "128.107539"
xref: delta_avge_mass "128.1922"
xref: delta_composition "H(14) C(7) N O"
xref: username_of_poster "xwei"
xref: group_of_poster "users"
xref: date_time_posted "2006-02-15 03:10:16"
xref: date_time_modified "2006-10-17 12:08:04"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_1_neutral_loss_60_mono_mass "59.073499"
xref: spec_1_neutral_loss_60_avge_mass "59.1103"
xref: spec_1_neutral_loss_60_flag "false"
xref: spec_1_neutral_loss_60_composition "H(9) C(3) N"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_2_neutral_loss_60_mono_mass "59.073499"
xref: spec_2_neutral_loss_60_avge_mass "59.1103"
xref: spec_2_neutral_loss_60_flag "false"
xref: spec_2_neutral_loss_60_composition "H(9) C(3) N"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:477
name: TMAB:2H(9)
def: "D9-4-trimethyllammoniumbutyryl-." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=477]
xref: record_id "477"
xref: delta_mono_mass "137.164030"
xref: delta_avge_mass "137.2476"
xref: delta_composition "H(5) 2H(9) C(7) N O"
xref: username_of_poster "xwei"
xref: group_of_poster "users"
xref: date_time_posted "2006-02-15 18:36:06"
xref: date_time_modified "2006-10-17 12:08:34"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_1_neutral_loss_69_mono_mass "68.129990"
xref: spec_1_neutral_loss_69_avge_mass "68.1657"
xref: spec_1_neutral_loss_69_flag "false"
xref: spec_1_neutral_loss_69_composition "2H(9) C(3) N"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_2_neutral_loss_69_mono_mass "68.129990"
xref: spec_2_neutral_loss_69_avge_mass "68.1657"
xref: spec_2_neutral_loss_69_flag "false"
xref: spec_2_neutral_loss_69_composition "2H(9) C(3) N"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:478
name: FTC
def: "Fluorescein-5-thiosemicarbazide." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=478]
xref: record_id "478"
xref: delta_mono_mass "421.073241"
xref: delta_avge_mass "421.4259"
xref: delta_composition "H(15) C(21) N(3) O(5) S"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2006-02-20 11:15:03"
xref: date_time_modified "2006-10-16 16:45:27"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "P"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "R"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Chemical derivative"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "S"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:481
name: Label:2H(4)
def: "4,4,5,5-D4 Lysine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=481]
comment: For SILAC experiments.
synonym: "K4" []
xref: record_id "481"
xref: delta_mono_mass "4.025107"
xref: delta_avge_mass "4.0246"
xref: delta_composition "H(-4) 2H(4)"
xref: username_of_poster "yunwah"
xref: group_of_poster "users"
xref: date_time_posted "2006-02-20 11:44:19"
xref: date_time_modified "2010-06-04 15:12:04"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "F"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Isotopic label"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Isotopic label"
xref: spec_3_misc_notes "Cambridge Labs DLM-451"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:488
name: DHP
def: "Dehydropyrrolizidine alkaloid (dehydroretronecine) on cysteines." [PMID:16222722, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=488]
synonym: "Dehydroretronecine" []
xref: record_id "488"
xref: delta_mono_mass "118.065674"
xref: delta_avge_mass "118.1558"
xref: delta_composition "H(8) C(8) N"
xref: username_of_poster "rowanrainbow"
xref: group_of_poster "users"
xref: date_time_posted "2006-03-07 08:40:13"
xref: date_time_modified "2006-10-17 12:07:19"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:490
name: Hep
def: "Heptose." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=490]
xref: record_id "490"
xref: delta_mono_mass "192.063388"
xref: delta_avge_mass "192.1666"
xref: delta_composition "Hep"
xref: username_of_poster "anikolakakis"
xref: group_of_poster "users"
xref: date_time_posted "2006-03-24 15:59:43"
xref: date_time_modified "2006-10-16 15:08:16"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "N-linked glycosylation"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Q"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "N-linked glycosylation"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "R"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "N-linked glycosylation"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "S"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "O-linked glycosylation"
xref: spec_6_group "6"
xref: spec_6_hidden "1"
xref: spec_6_site "T"
xref: spec_6_position "Anywhere"
xref: spec_6_classification "O-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:493
name: BADGE
def: "Bisphenol A diglycidyl ether derivative." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=493]
comment: Found in canned food products.
xref: record_id "493"
xref: delta_mono_mass "340.167459"
xref: delta_avge_mass "340.4129"
xref: delta_composition "H(24) C(21) O(4)"
xref: username_of_poster "TNO"
xref: group_of_poster "users"
xref: date_time_posted "2006-03-27 09:30:54"
xref: date_time_modified "2006-10-17 14:09:11"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Non-standard residue"
xref: spec_1_misc_notes "found in canned food products"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:494
name: CyDye-Cy3
def: "Cy3 CyDye DIGE Fluor saturation dye." [PMID:12872219, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=494]
xref: record_id "494"
xref: delta_mono_mass "672.298156"
xref: delta_avge_mass "672.8335"
xref: delta_composition "H(44) C(37) N(4) O(6) S"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2006-03-27 11:17:51"
xref: date_time_modified "2006-10-17 14:18:38"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:495
name: CyDye-Cy5
def: "Cy5 CyDye DIGE Fluor saturation dye." [PMID:12872219, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=495]
xref: record_id "495"
xref: delta_mono_mass "684.298156"
xref: delta_avge_mass "684.8442"
xref: delta_composition "H(44) C(38) N(4) O(6) S"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2006-03-27 11:53:04"
xref: date_time_modified "2006-10-17 14:18:49"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:498
name: BHTOH
def: "Michael addition of t-butyl hydroxylated BHT (BHTOH) to C, H or K." [PMID:16533022, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=498]
comment: BHTOH is formed upon metabolism of BHT with P450 enzymes. The BHTOH is further metabolized to its quinone methide (electrophile) which reacts with -SH and -NH2 groups.
synonym: "t-butyl hydroxylated BHT" []
xref: record_id "498"
xref: delta_mono_mass "234.161980"
xref: delta_avge_mass "234.3340"
xref: delta_composition "H(22) C(15) O(2)"
xref: username_of_poster "rkupfer"
xref: group_of_poster "users"
xref: date_time_posted "2006-04-10 19:27:51"
xref: date_time_modified "2006-10-17 13:42:22"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
xref: spec_1_misc_notes "primary adduct"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "H"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Other"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "K"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Other"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:499
name: IGBP:13C(2)
def: "Heavy IDBEST tag for quantitation." [URL:http\://www.targetdiscovery.com/index.php?topic=prod.idbe, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=499]
xref: record_id "499"
xref: delta_mono_mass "298.022748"
xref: delta_avge_mass "299.1331"
xref: delta_composition "H(13) C(10) 13C(2) N(2) O(2) Br"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2006-04-14 18:44:41"
xref: date_time_modified "2006-10-19 10:48:25"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:500
name: Nmethylmaleimide+water
def: "Nmethylmaleimidehydrolysis." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=500]
xref: record_id "500"
xref: delta_mono_mass "129.042593"
xref: delta_avge_mass "129.1140"
xref: delta_composition "H(7) C(5) N O(3)"
xref: username_of_poster "whaskins"
xref: group_of_poster "users"
xref: date_time_posted "2006-04-14 22:58:34"
xref: date_time_modified "2006-10-17 12:12:40"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:501
name: PyMIC
def: "3-methyl-2-pyridyl isocyanate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=501]
xref: record_id "501"
xref: delta_mono_mass "134.048013"
xref: delta_avge_mass "134.1353"
xref: delta_composition "H(6) C(7) N(2) O"
xref: username_of_poster "TING"
xref: group_of_poster "users"
xref: date_time_posted "2006-04-18 20:46:17"
xref: date_time_modified "2006-10-17 12:19:15"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N-term"
xref: spec_1_position "Any N-term"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:503
name: LG-lactam-K
def: "Levuglandinyl - lysine lactam adduct." [PMID:15650407, PMID:15752459, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=503]
xref: record_id "503"
xref: delta_mono_mass "332.198760"
xref: delta_avge_mass "332.4339"
xref: delta_composition "H(28) C(20) O(4)"
xref: username_of_poster "alexparf"
xref: group_of_poster "users"
xref: date_time_posted "2006-04-27 17:56:39"
xref: date_time_modified "2006-11-14 12:04:37"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Protein N-term"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:504
name: LG-Hlactam-K
def: "Levuglandinyl - lysine hydroxylactam adduct." [PMID:15650407, PMID:15752459, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=504]
xref: record_id "504"
xref: delta_mono_mass "348.193674"
xref: delta_avge_mass "348.4333"
xref: delta_composition "H(28) C(20) O(5)"
xref: username_of_poster "alexparf"
xref: group_of_poster "users"
xref: date_time_posted "2006-04-27 18:02:17"
xref: date_time_modified "2006-11-14 12:04:47"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Protein N-term"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:505
name: LG-lactam-R
def: "Levuglandinyl - arginine lactam adduct." [PMID:15650407, PMID:15752459, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=505]
xref: record_id "505"
xref: delta_mono_mass "290.176961"
xref: delta_avge_mass "290.3939"
xref: delta_composition "H(26) C(19) N(-2) O(4)"
xref: username_of_poster "alexparf"
xref: group_of_poster "users"
xref: date_time_posted "2006-04-27 18:05:11"
xref: date_time_modified "2006-10-17 14:08:20"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:506
name: LG-Hlactam-R
def: "Levuglandinyl - arginine hydroxylactam adduct." [PMID:15650407, PMID:15752459, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=506]
xref: record_id "506"
xref: delta_mono_mass "306.171876"
xref: delta_avge_mass "306.3933"
xref: delta_composition "H(26) C(19) N(-2) O(5)"
xref: username_of_poster "alexparf"
xref: group_of_poster "users"
xref: date_time_posted "2006-04-27 18:08:11"
xref: date_time_modified "2006-10-17 14:08:30"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:510
name: Dimethyl:2H(4)13C(2)
def: "DiMethyl-C13HD2." [PMID:16335955, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=510]
xref: record_id "510"
xref: delta_mono_mass "34.063117"
xref: delta_avge_mass "34.0631"
xref: delta_composition "2H(4) 13C(2)"
xref: username_of_poster "oded"
xref: group_of_poster "users"
xref: date_time_posted "2006-05-08 22:03:41"
xref: date_time_modified "2006-10-15 18:26:15"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:512
name: Hex(2)
def: "Lactosylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=512]
comment: Lactosylation of bovine Beta-Lactoglobulin.
synonym: "lac" []
xref: record_id "512"
xref: delta_mono_mass "324.105647"
xref: delta_avge_mass "324.2812"
xref: delta_composition "Hex(2)"
xref: username_of_poster "molle"
xref: group_of_poster "users"
xref: date_time_posted "2006-05-11 13:21:17"
xref: date_time_modified "2006-10-17 13:44:30"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other glycosylation"
xref: spec_1_misc_notes "Maillard reaction (first event)"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "R"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Other glycosylation"
xref: spec_2_misc_notes "Maillard reaction (first event)"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:513
name: C8-QAT
def: "[3-(2,5)-Dioxopyrrolidin-1-yloxycarbonyl)-propyl]dimethyloctylammonium." [PMID:16771548, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=513]
xref: record_id "513"
xref: delta_mono_mass "227.224915"
xref: delta_avge_mass "227.3862"
xref: delta_composition "H(29) C(14) N O"
xref: username_of_poster "amadian"
xref: group_of_poster "users"
xref: date_time_posted "2006-05-13 20:55:20"
xref: date_time_modified "2006-12-03 19:43:27"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:514
name: PropylNAGthiazoline
def: "Propyl-1,2-dideoxy-2\'-methyl-alpha-D-glucopyranoso-[2,1-d]-Delta2\'-thiazoline." [PMID:15795231, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=514]
comment: In a recent publication (see reference), we have shown that family 84 glycoside hydrolases contain a deep pocket beneath the 2-acetamido group of its substrate (N-acetyl-glucosamine). With this strucual feature in mind, we have designed a specific inhibitor that contains a chloride group appended to the end of the propyl chain on a known inhibitor termed propyl-NAG-thiazoline. We have shown kinetically that this molecule is a potent suicide inhibitor of this enzyme famiy and now wish to know the precise residue which is acting as the nucleophile to dispace the choride atom. We have included all residues that are in the vacinity of the chloride atom that could potentially act in a nucleophilic manner.
xref: record_id "514"
xref: delta_mono_mass "232.064354"
xref: delta_avge_mass "232.2768"
xref: delta_composition "H(14) C(9) N O(4) S"
xref: username_of_poster "mmacaule"
xref: group_of_poster "users"
xref: date_time_posted "2006-05-18 18:44:52"
xref: date_time_modified "2006-11-14 10:35:19"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:515
name: FNEM
def: "Fluorescein-5-maleimide." [PMID:9325338, PMID:11665566, URL:http\://probes.invitrogen.com/media/pis/mp00003.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=515]
synonym: "fluorescein-NEM" []
xref: record_id "515"
xref: delta_mono_mass "427.069202"
xref: delta_avge_mass "427.3625"
xref: delta_composition "H(13) C(24) N O(7)"
xref: username_of_poster "shure"
xref: group_of_poster "users"
xref: date_time_posted "2006-06-08 10:07:56"
xref: date_time_modified "2006-10-17 14:15:03"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_1_misc_notes "photosensitive"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:518
name: Diethyl
def: "Diethylation, analogous to Dimethylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=518]
xref: record_id "518"
xref: delta_mono_mass "56.062600"
xref: delta_avge_mass "56.1063"
xref: delta_composition "H(8) C(4)"
xref: username_of_poster "PhilipHsu"
xref: group_of_poster "users"
xref: date_time_posted "2006-06-15 07:18:26"
xref: date_time_modified "2006-10-17 12:00:33"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:519
name: BisANS
def: "4,4\'-dianilino-1,1\'-binaphthyl-5,5\'-disulfonic acid." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=519]
xref: record_id "519"
xref: delta_mono_mass "592.076278"
xref: delta_avge_mass "592.6410"
xref: delta_composition "H(20) C(32) N(2) O(6) S(2)"
xref: username_of_poster "app95d"
xref: group_of_poster "users"
xref: date_time_posted "2006-07-05 23:31:08"
xref: date_time_modified "2006-10-17 14:18:24"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:520
name: Piperidine
def: "Piperidination." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=520]
xref: record_id "520"
xref: delta_mono_mass "68.062600"
xref: delta_avge_mass "68.1170"
xref: delta_composition "H(8) C(5)"
xref: username_of_poster "PhilipHsu"
xref: group_of_poster "users"
xref: date_time_posted "2006-07-20 08:37:21"
xref: date_time_modified "2006-10-17 12:05:44"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:522
name: Maleimide-PEO2-Biotin
def: "Maleimide-Biotin." [URL:http\://www.piercenet.com/Products/Browse.cfm?fldID=01031005, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=522]
synonym: "Maleimide-PEG2-Biotin" []
xref: record_id "522"
xref: delta_mono_mass "525.225719"
xref: delta_avge_mass "525.6183"
xref: delta_composition "H(35) C(23) N(5) O(7) S"
xref: username_of_poster "ericjohansen"
xref: group_of_poster "users"
xref: date_time_posted "2006-08-11 02:49:51"
xref: date_time_modified "2010-12-03 16:13:49"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:523
name: Sulfo-NHS-LC-LC-Biotin
def: "Biot_LC_LC." [URL:http\://www.piercenet.com/Products/Browse.cfm?fldID=8D38BA83-EFDC-421A-853F-E96EBA380612, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=523]
synonym: "Sulfo-NHS-LC-LC-Biotin" []
xref: record_id "523"
xref: delta_mono_mass "452.245726"
xref: delta_avge_mass "452.6106"
xref: delta_composition "H(36) C(22) N(4) O(4) S"
xref: username_of_poster "unimod"
xref: group_of_poster "admin"
xref: date_time_posted "2006-08-31 18:01:50"
xref: date_time_modified "2010-12-03 16:11:08"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:525
name: CLIP_TRAQ_2
def: "CLIP_TRAQ_2." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=525]
comment: CLIP-TRAQ-2 H(17) C(10) C13 N(3) O(4) is an in-house made compound that reacts with primary amines through a N-hydroxysuccinimide group leading to a 141.0983 Da mass shift (monoisotopic) in MS mode. The reporter ion in MS/MS mode can either be 113 or 114 m/z depending on the position of isotopic C13 in the molecule. (Fahlman, R. and Overall, C.M. ; in preparation).
synonym: "CLIP_TRAQ_double" []
xref: record_id "525"
xref: delta_mono_mass "141.098318"
xref: delta_avge_mass "141.1756"
xref: delta_composition "H(12) C(6) 13C N(2) O"
xref: username_of_poster "overalllab"
xref: group_of_poster "users"
xref: date_time_posted "2006-09-15 02:25:46"
xref: date_time_modified "2006-10-17 18:04:46"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Isotopic label"
xref: spec_3_misc_notes "Side reaction, low abundance"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:526
name: Dethiomethyl
def: "Prompt loss of side chain from oxidised Met." [PMID:9004526, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=526]
comment: More commonly seen as a neutral loss.
xref: record_id "526"
xref: delta_mono_mass "-48.003371"
xref: delta_avge_mass "-48.1075"
xref: delta_composition "H(-4) C(-1) S(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-10-13 15:14:55"
xref: date_time_modified "2006-10-13 17:02:27"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "M"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:528
name: Methyl+Deamidated
def: "Deamidation followed by a methylation." [FindMod:DEAME, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=528]
synonym: "Glutamate methyl ester" []
xref: record_id "528"
xref: delta_mono_mass "14.999666"
xref: delta_avge_mass "15.0113"
xref: delta_composition "H C N(-1) O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-10-14 10:39:08"
xref: date_time_modified "2007-02-04 12:25:42"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Q"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:529
name: Delta:H(5)C(2)
def: "Dimethylation of proline residue." [FindMod:DIMETP, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=529]
xref: record_id "529"
xref: delta_mono_mass "29.039125"
xref: delta_avge_mass "29.0611"
xref: delta_composition "H(5) C(2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-10-15 18:02:34"
xref: date_time_modified "2006-10-15 18:03:16"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "P"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:530
name: Cation:K
def: "Replacement of proton by potassium." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=530]
xref: record_id "530"
xref: delta_mono_mass "37.955882"
xref: delta_avge_mass "38.0904"
xref: delta_composition "H(-1) K"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-10-15 18:29:43"
xref: date_time_modified "2006-10-18 11:17:39"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "E"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "D"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "C-term"
xref: spec_2_position "Any C-term"
xref: spec_2_classification "Artefact"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:531
name: Cation:Cu[I]
def: "Replacement of proton by copper." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=531]
xref: record_id "531"
xref: delta_mono_mass "61.921774"
xref: delta_avge_mass "62.5381"
xref: delta_composition "H(-1) Cu"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-10-16 10:29:12"
xref: date_time_modified "2006-11-14 10:38:36"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "E"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "D"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "C-term"
xref: spec_2_position "Any C-term"
xref: spec_2_classification "Artefact"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:532
name: iTRAQ4plex114
def: "Accurate mass for 114." [URL:http\://docs.appliedbiosystems.com/pebiodocs/04351918.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=532]
comment: Different channels have the same nominal mass but slightly different exact masses.
synonym: "Applied Biosystems iTRAQ(TM) multiplexed quantitation chemistry" []
xref: record_id "532"
xref: delta_mono_mass "144.105918"
xref: delta_avge_mass "144.1680"
xref: delta_composition "H(12) C(5) 13C(2) N(2) 18O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-10-16 13:46:49"
xref: date_time_modified "2006-12-09 18:48:09"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Isotopic label"
xref: spec_3_misc_notes "Low abundance"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:533
name: iTRAQ4plex115
def: "Accurate mass for 115." [URL:http\://docs.appliedbiosystems.com/pebiodocs/04351918.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=533]
comment: Different channels have the same nominal mass but slightly different exact masses.
synonym: "Applied Biosystems iTRAQ(TM) multiplexed quantitation chemistry" []
xref: record_id "533"
xref: delta_mono_mass "144.099599"
xref: delta_avge_mass "144.1688"
xref: delta_composition "H(12) C(6) 13C N 15N 18O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-10-16 13:48:16"
xref: date_time_modified "2006-12-09 18:47:52"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Isotopic label"
xref: spec_3_misc_notes "Low abundance"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:534
name: Dibromo
def: "Dibromo." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=534]
xref: record_id "534"
xref: delta_mono_mass "155.821022"
xref: delta_avge_mass "157.7921"
xref: delta_composition "H(-2) Br(2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-10-16 14:06:38"
xref: date_time_modified "2006-10-16 14:06:38"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Y"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:535
name: LeuArgGlyGly
def: "Ubiquitination." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=535]
synonym: "Addition of LRGG" []
xref: record_id "535"
xref: delta_mono_mass "383.228103"
xref: delta_avge_mass "383.4460"
xref: delta_composition "H(29) C(16) N(7) O(4)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-10-16 16:39:05"
xref: date_time_modified "2006-10-16 16:39:05"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:536
name: CLIP_TRAQ_3
def: "CLIP_TRAQ_3." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=536]
comment: CLIP_TRAQ_3 (H(20) C(11) C13 N(3) O(4) is an in-house made compound that reacts with primary amines through a N-hydroxysuccinimide group leading to a 155.1 Da mass shift (monoisotopic) in MS mode. The reporter ion in MS/MS mode can either be 127 or 128 m/z depending on the position of isotopic C13 in the molecule. (Fahlman, R. and Overall, C.M. ; in preparation).
xref: record_id "536"
xref: delta_mono_mass "271.148736"
xref: delta_avge_mass "271.2976"
xref: delta_composition "H(20) C(11) 13C N(3) O(4)"
xref: username_of_poster "overall"
xref: group_of_poster ""
xref: date_time_posted "2006-10-17 18:08:00"
xref: date_time_modified "2006-10-17 18:11:03"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Isotopic label"
xref: spec_3_misc_notes "Low abundance"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:537
name: CLIP_TRAQ_4
def: "CLIP_TRAQ_4." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=537]
comment: CLIP_TRAQ_4 is an in-house made compound that reacts with primary amines through a N-hydroxysuccinimide group leading to a 128.1 Da mass shift (monoisotopic) in MS mode. The reporter ion in MS/MS mode can either be 100 or 101 m/z depending on the position of isotopic C13 in the molecule. (Fahlman, R. and Overall, C.M. ; in preparation).
xref: record_id "537"
xref: delta_mono_mass "244.101452"
xref: delta_avge_mass "244.2292"
xref: delta_composition "H(15) C(9) 13C N(2) O(5)"
xref: username_of_poster "overall"
xref: group_of_poster ""
xref: date_time_posted "2006-10-17 18:09:22"
xref: date_time_modified "2006-10-17 18:10:05"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Isotopic label"
xref: spec_3_misc_notes "Low abundance"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:538
name: Biotin:Cayman-10141
def: "Was 15dB-biotin." [URL:http\://www.caymanchem.com/pdfs/10141.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=538]
synonym: "15-deoxy-delta 12,14-Prostaglandin J2-biotinimide" []
xref: record_id "538"
xref: delta_mono_mass "626.386577"
xref: delta_avge_mass "626.8927"
xref: delta_composition "H(54) C(35) N(4) O(4) S"
xref: username_of_poster "sevgh"
xref: group_of_poster ""
xref: date_time_posted "2006-10-17 18:13:45"
xref: date_time_modified "2010-12-03 16:08:40"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:539
name: Biotin:Cayman-10013
def: "Was PGA1-biotin." [URL:http\://www.caymanchem.com/pdfs/10013.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=539]
synonym: "Prostaglandin A1-biotinimide" []
xref: record_id "539"
xref: delta_mono_mass "660.428442"
xref: delta_avge_mass "660.9504"
xref: delta_composition "H(60) C(36) N(4) O(5) S"
xref: username_of_poster "sevgh"
xref: group_of_poster ""
xref: date_time_posted "2006-10-17 18:24:06"
xref: date_time_modified "2010-12-03 16:07:57"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:540
name: Ala->Ser
def: "Ala->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=540]
xref: record_id "540"
xref: delta_mono_mass "15.994915"
xref: delta_avge_mass "15.9994"
xref: delta_composition "O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 10:07:30"
xref: date_time_modified "2006-11-09 10:07:30"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "A"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:541
name: Ala->Thr
def: "Ala->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=541]
xref: record_id "541"
xref: delta_mono_mass "30.010565"
xref: delta_avge_mass "30.0260"
xref: delta_composition "H(2) C O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 10:13:43"
xref: date_time_modified "2006-11-09 10:13:43"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "A"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:542
name: Ala->Asp
def: "Ala->Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=542]
xref: record_id "542"
xref: delta_mono_mass "43.989829"
xref: delta_avge_mass "44.0095"
xref: delta_composition "C O(2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 10:15:05"
xref: date_time_modified "2006-11-09 10:15:05"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "A"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:543
name: Ala->Pro
def: "Ala->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=543]
xref: record_id "543"
xref: delta_mono_mass "26.015650"
xref: delta_avge_mass "26.0373"
xref: delta_composition "H(2) C(2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 10:16:03"
xref: date_time_modified "2006-11-09 10:16:03"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "A"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:544
name: Ala->Gly
def: "Ala->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=544]
xref: record_id "544"
xref: delta_mono_mass "-14.015650"
xref: delta_avge_mass "-14.0266"
xref: delta_composition "H(-2) C(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 10:16:35"
xref: date_time_modified "2006-11-09 10:16:35"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "A"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:545
name: Ala->Glu
def: "Ala->Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=545]
xref: record_id "545"
xref: delta_mono_mass "58.005479"
xref: delta_avge_mass "58.0361"
xref: delta_composition "H(2) C(2) O(2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 10:19:56"
xref: date_time_modified "2006-11-09 10:19:56"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "A"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:546
name: Ala->Val
def: "Ala->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=546]
xref: record_id "546"
xref: delta_mono_mass "28.031300"
xref: delta_avge_mass "28.0532"
xref: delta_composition "H(4) C(2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 10:20:15"
xref: date_time_modified "2006-11-09 10:20:15"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "A"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:547
name: Cys->Phe
def: "Cys->Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=547]
xref: record_id "547"
xref: delta_mono_mass "44.059229"
xref: delta_avge_mass "44.0310"
xref: delta_composition "H(4) C(6) S(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 10:20:41"
xref: date_time_modified "2006-11-09 10:20:41"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:548
name: Cys->Ser
def: "Cys->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=548]
xref: record_id "548"
xref: delta_mono_mass "-15.977156"
xref: delta_avge_mass "-16.0656"
xref: delta_composition "O S(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 10:21:13"
xref: date_time_modified "2006-11-09 10:21:13"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:549
name: Cys->Trp
def: "Cys->Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=549]
xref: record_id "549"
xref: delta_mono_mass "83.070128"
xref: delta_avge_mass "83.0670"
xref: delta_composition "H(5) C(8) N S(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 10:21:37"
xref: date_time_modified "2006-11-09 10:21:37"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:550
name: Cys->Tyr
def: "Cys->Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=550]
xref: record_id "550"
xref: delta_mono_mass "60.054144"
xref: delta_avge_mass "60.0304"
xref: delta_composition "H(4) C(6) O S(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 10:22:04"
xref: date_time_modified "2006-11-09 10:22:04"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:551
name: Cys->Arg
def: "Cys->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=551]
xref: record_id "551"
xref: delta_mono_mass "53.091927"
xref: delta_avge_mass "53.0428"
xref: delta_composition "H(7) C(3) N(3) S(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 10:22:25"
xref: date_time_modified "2006-11-09 10:22:25"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:552
name: Cys->Gly
def: "Cys->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=552]
xref: record_id "552"
xref: delta_mono_mass "-45.987721"
xref: delta_avge_mass "-46.0916"
xref: delta_composition "H(-2) C(-1) S(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 10:22:43"
xref: date_time_modified "2006-11-09 10:22:43"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:553
name: Asp->Ala
def: "Asp->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=553]
xref: record_id "553"
xref: delta_mono_mass "-43.989829"
xref: delta_avge_mass "-44.0095"
xref: delta_composition "C(-1) O(-2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 10:53:54"
xref: date_time_modified "2006-11-09 10:53:54"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "D"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:554
name: Asp->His
def: "Asp->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=554]
xref: record_id "554"
xref: delta_mono_mass "22.031969"
xref: delta_avge_mass "22.0519"
xref: delta_composition "H(2) C(2) N(2) O(-2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 10:55:25"
xref: date_time_modified "2006-11-09 10:55:25"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "D"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:555
name: Asp->Asn
def: "Asp->Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=555]
xref: record_id "555"
xref: delta_mono_mass "-0.984016"
xref: delta_avge_mass "-0.9848"
xref: delta_composition "H N O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 10:55:49"
xref: date_time_modified "2006-11-09 10:55:49"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "D"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:556
name: Asp->Gly
def: "Asp->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=556]
xref: record_id "556"
xref: delta_mono_mass "-58.005479"
xref: delta_avge_mass "-58.0361"
xref: delta_composition "H(-2) C(-2) O(-2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 10:56:52"
xref: date_time_modified "2006-11-09 10:56:52"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "D"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:557
name: Asp->Tyr
def: "Asp->Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=557]
xref: record_id "557"
xref: delta_mono_mass "48.036386"
xref: delta_avge_mass "48.0859"
xref: delta_composition "H(4) C(5) O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 10:58:23"
xref: date_time_modified "2006-11-09 10:58:23"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "D"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:558
name: Asp->Glu
def: "Asp->Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=558]
xref: record_id "558"
xref: delta_mono_mass "14.015650"
xref: delta_avge_mass "14.0266"
xref: delta_composition "H(2) C"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 10:58:44"
xref: date_time_modified "2006-11-09 10:58:44"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "D"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:559
name: Asp->Val
def: "Asp->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=559]
xref: record_id "559"
xref: delta_mono_mass "-15.958529"
xref: delta_avge_mass "-15.9563"
xref: delta_composition "H(4) C O(-2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 10:59:02"
xref: date_time_modified "2006-11-09 10:59:02"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "D"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:560
name: Glu->Ala
def: "Glu->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=560]
xref: record_id "560"
xref: delta_mono_mass "-58.005479"
xref: delta_avge_mass "-58.0361"
xref: delta_composition "H(-2) C(-2) O(-2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:00:54"
xref: date_time_modified "2006-11-09 11:00:54"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "E"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:561
name: Glu->Gln
def: "Glu->Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=561]
xref: record_id "561"
xref: delta_mono_mass "-0.984016"
xref: delta_avge_mass "-0.9848"
xref: delta_composition "H N O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:01:29"
xref: date_time_modified "2006-11-09 11:01:29"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "E"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:562
name: Glu->Asp
def: "Glu->Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=562]
xref: record_id "562"
xref: delta_mono_mass "-14.015650"
xref: delta_avge_mass "-14.0266"
xref: delta_composition "H(-2) C(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:01:53"
xref: date_time_modified "2006-11-09 11:01:53"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "E"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:563
name: Glu->Lys
def: "Glu->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=563]
xref: record_id "563"
xref: delta_mono_mass "-0.947630"
xref: delta_avge_mass "-0.9417"
xref: delta_composition "H(5) C N O(-2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:02:15"
xref: date_time_modified "2006-11-09 11:02:15"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "E"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:564
name: Glu->Gly
def: "Glu->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=564]
xref: record_id "564"
xref: delta_mono_mass "-72.021129"
xref: delta_avge_mass "-72.0627"
xref: delta_composition "H(-4) C(-3) O(-2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:02:36"
xref: date_time_modified "2006-11-09 11:02:36"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "E"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:565
name: Glu->Val
def: "Glu->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=565]
xref: record_id "565"
xref: delta_mono_mass "-29.974179"
xref: delta_avge_mass "-29.9829"
xref: delta_composition "H(2) O(-2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:03:02"
xref: date_time_modified "2006-11-09 11:03:02"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "E"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:566
name: Phe->Ser
def: "Phe->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=566]
xref: record_id "566"
xref: delta_mono_mass "-60.036386"
xref: delta_avge_mass "-60.0966"
xref: delta_composition "H(-4) C(-6) O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:03:29"
xref: date_time_modified "2006-11-09 11:03:29"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "F"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:567
name: Phe->Cys
def: "Phe->Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=567]
xref: record_id "567"
xref: delta_mono_mass "-44.059229"
xref: delta_avge_mass "-44.0310"
xref: delta_composition "H(-4) C(-6) S"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:04:01"
xref: date_time_modified "2006-11-09 11:04:01"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "F"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:568
name: Phe->Xle
def: "Phe->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=568]
xref: record_id "568"
xref: delta_mono_mass "-33.984350"
xref: delta_avge_mass "-34.0162"
xref: delta_composition "H(2) C(-3)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:05:41"
xref: date_time_modified "2011-06-21 15:10:27"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "F"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:569
name: Phe->Tyr
def: "Phe->Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=569]
xref: record_id "569"
xref: delta_mono_mass "15.994915"
xref: delta_avge_mass "15.9994"
xref: delta_composition "O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:06:56"
xref: date_time_modified "2006-11-09 11:06:56"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "F"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:570
name: Phe->Val
def: "Phe->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=570]
xref: record_id "570"
xref: delta_mono_mass "-48.000000"
xref: delta_avge_mass "-48.0428"
xref: delta_composition "C(-4)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:07:20"
xref: date_time_modified "2006-11-09 11:07:20"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "F"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:571
name: Gly->Ala
def: "Gly->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=571]
xref: record_id "571"
xref: delta_mono_mass "14.015650"
xref: delta_avge_mass "14.0266"
xref: delta_composition "H(2) C"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:07:51"
xref: date_time_modified "2006-11-09 11:07:51"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "G"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:572
name: Gly->Ser
def: "Gly->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=572]
xref: record_id "572"
xref: delta_mono_mass "30.010565"
xref: delta_avge_mass "30.0260"
xref: delta_composition "H(2) C O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:08:13"
xref: date_time_modified "2006-11-09 11:08:13"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "G"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:573
name: Gly->Trp
def: "Gly->Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=573]
xref: record_id "573"
xref: delta_mono_mass "129.057849"
xref: delta_avge_mass "129.1586"
xref: delta_composition "H(7) C(9) N"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:08:33"
xref: date_time_modified "2006-11-09 11:08:33"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "G"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:574
name: Gly->Glu
def: "Gly->Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=574]
xref: record_id "574"
xref: delta_mono_mass "72.021129"
xref: delta_avge_mass "72.0627"
xref: delta_composition "H(4) C(3) O(2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:08:57"
xref: date_time_modified "2006-11-09 11:08:57"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "G"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:575
name: Gly->Val
def: "Gly->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=575]
xref: record_id "575"
xref: delta_mono_mass "42.046950"
xref: delta_avge_mass "42.0797"
xref: delta_composition "H(6) C(3)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:09:18"
xref: date_time_modified "2006-11-09 11:09:18"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "G"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:576
name: Gly->Asp
def: "Gly->Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=576]
xref: record_id "576"
xref: delta_mono_mass "58.005479"
xref: delta_avge_mass "58.0361"
xref: delta_composition "H(2) C(2) O(2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:09:44"
xref: date_time_modified "2006-11-09 11:09:44"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "G"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:577
name: Gly->Cys
def: "Gly->Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=577]
xref: record_id "577"
xref: delta_mono_mass "45.987721"
xref: delta_avge_mass "46.0916"
xref: delta_composition "H(2) C S"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:10:03"
xref: date_time_modified "2006-11-09 11:10:03"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "G"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:578
name: Gly->Arg
def: "Gly->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=578]
xref: record_id "578"
xref: delta_mono_mass "99.079647"
xref: delta_avge_mass "99.1344"
xref: delta_composition "H(9) C(4) N(3)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:10:23"
xref: date_time_modified "2006-11-09 11:10:23"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "G"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:580
name: His->Pro
def: "His->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=580]
xref: record_id "580"
xref: delta_mono_mass "-40.006148"
xref: delta_avge_mass "-40.0241"
xref: delta_composition "C(-1) N(-2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:11:29"
xref: date_time_modified "2006-11-09 11:11:29"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "H"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:581
name: His->Tyr
def: "His->Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=581]
xref: record_id "581"
xref: delta_mono_mass "26.004417"
xref: delta_avge_mass "26.0340"
xref: delta_composition "H(2) C(3) N(-2) O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:11:50"
xref: date_time_modified "2006-11-09 11:11:50"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "H"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:582
name: His->Gln
def: "His->Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=582]
xref: record_id "582"
xref: delta_mono_mass "-9.000334"
xref: delta_avge_mass "-9.0101"
xref: delta_composition "H C(-1) N(-1) O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:14:42"
xref: date_time_modified "2006-11-09 11:14:42"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "H"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:584
name: His->Arg
def: "His->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=584]
xref: record_id "584"
xref: delta_mono_mass "19.042199"
xref: delta_avge_mass "19.0464"
xref: delta_composition "H(5) N"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:15:26"
xref: date_time_modified "2006-11-09 11:15:26"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "H"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:585
name: His->Xle
def: "His->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=585]
xref: record_id "585"
xref: delta_mono_mass "-23.974848"
xref: delta_avge_mass "-23.9816"
xref: delta_composition "H(4) N(-2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:15:51"
xref: date_time_modified "2011-06-21 15:10:11"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "H"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:588
name: Xle->Thr
def: "Leu/Ile->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=588]
xref: record_id "588"
xref: delta_mono_mass "-12.036386"
xref: delta_avge_mass "-12.0538"
xref: delta_composition "H(-4) C(-2) O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:18:09"
xref: date_time_modified "2011-06-21 15:29:22"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "I"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "L"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:589
name: Xle->Asn
def: "Leu/Ile->Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=589]
xref: record_id "589"
xref: delta_mono_mass "0.958863"
xref: delta_avge_mass "0.9450"
xref: delta_composition "H(-5) C(-2) N O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:18:31"
xref: date_time_modified "2011-06-21 15:29:41"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "I"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "L"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:590
name: Xle->Lys
def: "Leu/Ile->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=590]
xref: record_id "590"
xref: delta_mono_mass "15.010899"
xref: delta_avge_mass "15.0146"
xref: delta_composition "H N"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:18:57"
xref: date_time_modified "2011-06-21 15:27:59"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "I"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "L"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:594
name: Lys->Thr
def: "Lys->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=594]
xref: record_id "594"
xref: delta_mono_mass "-27.047285"
xref: delta_avge_mass "-27.0684"
xref: delta_composition "H(-5) C(-2) N(-1) O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:20:28"
xref: date_time_modified "2006-11-09 11:20:28"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:595
name: Lys->Asn
def: "Lys->Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=595]
xref: record_id "595"
xref: delta_mono_mass "-14.052036"
xref: delta_avge_mass "-14.0696"
xref: delta_composition "H(-6) C(-2) O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:20:51"
xref: date_time_modified "2006-11-09 11:20:51"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:596
name: Lys->Glu
def: "Lys->Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=596]
xref: record_id "596"
xref: delta_mono_mass "0.947630"
xref: delta_avge_mass "0.9417"
xref: delta_composition "H(-5) C(-1) N(-1) O(2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:21:12"
xref: date_time_modified "2006-11-09 11:21:12"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:597
name: Lys->Gln
def: "Lys->Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=597]
xref: record_id "597"
xref: delta_mono_mass "-0.036386"
xref: delta_avge_mass "-0.0431"
xref: delta_composition "H(-4) C(-1) O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:21:32"
xref: date_time_modified "2006-11-09 11:21:32"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:598
name: Lys->Met
def: "Lys->Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=598]
xref: record_id "598"
xref: delta_mono_mass "2.945522"
xref: delta_avge_mass "3.0238"
xref: delta_composition "H(-3) C(-1) N(-1) S"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:21:56"
xref: date_time_modified "2006-11-09 11:21:56"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:599
name: Lys->Arg
def: "Lys->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=599]
xref: record_id "599"
xref: delta_mono_mass "28.006148"
xref: delta_avge_mass "28.0134"
xref: delta_composition "N(2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:22:15"
xref: date_time_modified "2006-11-09 11:22:15"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:600
name: Lys->Xle
def: "Lys->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=600]
xref: record_id "600"
xref: delta_mono_mass "-15.010899"
xref: delta_avge_mass "-15.0146"
xref: delta_composition "H(-1) N(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:22:38"
xref: date_time_modified "2011-06-21 15:25:01"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:601
name: Xle->Ser
def: "Leu/Ile->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=601]
xref: record_id "601"
xref: delta_mono_mass "-26.052036"
xref: delta_avge_mass "-26.0803"
xref: delta_composition "H(-6) C(-3) O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:23:01"
xref: date_time_modified "2011-06-21 15:29:50"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "L"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "I"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:602
name: Xle->Phe
def: "Leu/Ile->Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=602]
xref: record_id "602"
xref: delta_mono_mass "33.984350"
xref: delta_avge_mass "34.0162"
xref: delta_composition "H(-2) C(3)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:23:22"
xref: date_time_modified "2011-06-21 15:28:53"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "L"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "I"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:603
name: Xle->Trp
def: "Leu/Ile->Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=603]
xref: record_id "603"
xref: delta_mono_mass "72.995249"
xref: delta_avge_mass "73.0523"
xref: delta_composition "H(-1) C(5) N"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:23:48"
xref: date_time_modified "2011-06-21 15:28:22"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "L"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "I"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:604
name: Xle->Pro
def: "Leu/Ile->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=604]
xref: record_id "604"
xref: delta_mono_mass "-16.031300"
xref: delta_avge_mass "-16.0425"
xref: delta_composition "H(-4) C(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:24:06"
xref: date_time_modified "2011-06-21 15:29:13"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "L"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "I"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:605
name: Xle->Val
def: "Leu/Ile->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=605]
xref: record_id "605"
xref: delta_mono_mass "-14.015650"
xref: delta_avge_mass "-14.0266"
xref: delta_composition "H(-2) C(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:24:28"
xref: date_time_modified "2011-06-21 15:28:33"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "L"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "I"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:606
name: Xle->His
def: "Leu/Ile->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=606]
xref: record_id "606"
xref: delta_mono_mass "23.974848"
xref: delta_avge_mass "23.9816"
xref: delta_composition "H(-4) N(2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:24:50"
xref: date_time_modified "2011-06-21 15:29:31"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "L"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "I"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:607
name: Xle->Gln
def: "Leu/Ile->Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=607]
xref: record_id "607"
xref: delta_mono_mass "14.974514"
xref: delta_avge_mass "14.9716"
xref: delta_composition "H(-3) C(-1) N O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:25:14"
xref: date_time_modified "2011-06-21 15:29:03"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "L"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "I"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:608
name: Xle->Met
def: "Leu/Ile->Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=608]
xref: record_id "608"
xref: delta_mono_mass "17.956421"
xref: delta_avge_mass "18.0384"
xref: delta_composition "H(-2) C(-1) S"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:25:59"
xref: date_time_modified "2011-06-21 15:28:43"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "L"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "I"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:609
name: Xle->Arg
def: "Leu/Ile->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=609]
xref: record_id "609"
xref: delta_mono_mass "43.017047"
xref: delta_avge_mass "43.0280"
xref: delta_composition "H N(3)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:26:21"
xref: date_time_modified "2011-06-21 15:28:11"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "L"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "I"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:610
name: Met->Thr
def: "Met->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=610]
xref: record_id "610"
xref: delta_mono_mass "-29.992806"
xref: delta_avge_mass "-30.0922"
xref: delta_composition "H(-2) C(-1) O S(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:26:47"
xref: date_time_modified "2006-11-09 11:26:47"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "M"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:611
name: Met->Arg
def: "Met->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=611]
xref: record_id "611"
xref: delta_mono_mass "25.060626"
xref: delta_avge_mass "24.9896"
xref: delta_composition "H(3) C N(3) S(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:27:10"
xref: date_time_modified "2006-11-09 11:27:10"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "M"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:613
name: Met->Lys
def: "Met->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=613]
xref: record_id "613"
xref: delta_mono_mass "-2.945522"
xref: delta_avge_mass "-3.0238"
xref: delta_composition "H(3) C N S(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:28:29"
xref: date_time_modified "2006-11-09 11:28:29"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "M"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:614
name: Met->Xle
def: "Met->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=614]
xref: record_id "614"
xref: delta_mono_mass "-17.956421"
xref: delta_avge_mass "-18.0384"
xref: delta_composition "H(2) C S(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:28:56"
xref: date_time_modified "2011-06-21 15:09:53"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "M"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:615
name: Met->Val
def: "Met->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=615]
xref: record_id "615"
xref: delta_mono_mass "-31.972071"
xref: delta_avge_mass "-32.0650"
xref: delta_composition "S(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:29:27"
xref: date_time_modified "2006-11-09 11:29:27"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "M"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:616
name: Asn->Ser
def: "Asn->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=616]
xref: record_id "616"
xref: delta_mono_mass "-27.010899"
xref: delta_avge_mass "-27.0253"
xref: delta_composition "H(-1) C(-1) N(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:29:57"
xref: date_time_modified "2006-11-09 11:29:57"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:617
name: Asn->Thr
def: "Asn->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=617]
xref: record_id "617"
xref: delta_mono_mass "-12.995249"
xref: delta_avge_mass "-12.9988"
xref: delta_composition "H N(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:34:11"
xref: date_time_modified "2006-11-09 11:34:11"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:618
name: Asn->Lys
def: "Asn->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=618]
xref: record_id "618"
xref: delta_mono_mass "14.052036"
xref: delta_avge_mass "14.0696"
xref: delta_composition "H(6) C(2) O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:34:31"
xref: date_time_modified "2006-11-09 11:34:31"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:619
name: Asn->Tyr
def: "Asn->Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=619]
xref: record_id "619"
xref: delta_mono_mass "49.020401"
xref: delta_avge_mass "49.0706"
xref: delta_composition "H(3) C(5) N(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:34:56"
xref: date_time_modified "2006-11-09 11:34:56"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:620
name: Asn->His
def: "Asn->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=620]
xref: record_id "620"
xref: delta_mono_mass "23.015984"
xref: delta_avge_mass "23.0366"
xref: delta_composition "H C(2) N O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:35:18"
xref: date_time_modified "2006-11-09 11:35:18"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:621
name: Asn->Asp
def: "Asn->Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=621]
xref: record_id "621"
xref: delta_mono_mass "0.984016"
xref: delta_avge_mass "0.9848"
xref: delta_composition "H(-1) N(-1) O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:35:42"
xref: date_time_modified "2006-11-09 11:35:42"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:622
name: Asn->Xle
def: "Asn->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=622]
xref: record_id "622"
xref: delta_mono_mass "-0.958863"
xref: delta_avge_mass "-0.9450"
xref: delta_composition "H(5) C(2) N(-1) O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:36:02"
xref: date_time_modified "2011-06-21 15:13:54"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:623
name: Pro->Ser
def: "Pro->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=623]
xref: record_id "623"
xref: delta_mono_mass "-10.020735"
xref: delta_avge_mass "-10.0379"
xref: delta_composition "H(-2) C(-2) O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:36:26"
xref: date_time_modified "2006-11-09 11:36:26"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "P"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:624
name: Pro->Ala
def: "Pro->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=624]
xref: record_id "624"
xref: delta_mono_mass "-26.015650"
xref: delta_avge_mass "-26.0373"
xref: delta_composition "H(-2) C(-2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:37:56"
xref: date_time_modified "2006-11-09 11:37:56"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "P"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:625
name: Pro->His
def: "Pro->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=625]
xref: record_id "625"
xref: delta_mono_mass "40.006148"
xref: delta_avge_mass "40.0241"
xref: delta_composition "C N(2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:38:18"
xref: date_time_modified "2006-11-09 11:38:18"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "P"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:626
name: Pro->Gln
def: "Pro->Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=626]
xref: record_id "626"
xref: delta_mono_mass "31.005814"
xref: delta_avge_mass "31.0140"
xref: delta_composition "H N O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:38:40"
xref: date_time_modified "2006-11-09 11:38:40"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "P"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:627
name: Pro->Thr
def: "Pro->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=627]
xref: record_id "627"
xref: delta_mono_mass "3.994915"
xref: delta_avge_mass "3.9887"
xref: delta_composition "C(-1) O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:39:02"
xref: date_time_modified "2006-11-09 11:39:02"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "P"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:628
name: Pro->Arg
def: "Pro->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=628]
xref: record_id "628"
xref: delta_mono_mass "59.048347"
xref: delta_avge_mass "59.0705"
xref: delta_composition "H(5) C N(3)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:39:29"
xref: date_time_modified "2006-11-09 11:39:29"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "P"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:629
name: Pro->Xle
def: "Pro->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=629]
xref: record_id "629"
xref: delta_mono_mass "16.031300"
xref: delta_avge_mass "16.0425"
xref: delta_composition "H(4) C"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:39:47"
xref: date_time_modified "2011-06-21 15:09:36"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "P"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:630
name: Gln->Pro
def: "Gln->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=630]
xref: record_id "630"
xref: delta_mono_mass "-31.005814"
xref: delta_avge_mass "-31.0140"
xref: delta_composition "H(-1) N(-1) O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:40:19"
xref: date_time_modified "2006-11-09 11:40:19"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Q"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:631
name: Gln->Lys
def: "Gln->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=631]
xref: record_id "631"
xref: delta_mono_mass "0.036386"
xref: delta_avge_mass "0.0431"
xref: delta_composition "H(4) C O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:42:17"
xref: date_time_modified "2006-11-09 11:42:17"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Q"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:632
name: Gln->Glu
def: "Gln->Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=632]
xref: record_id "632"
xref: delta_mono_mass "0.984016"
xref: delta_avge_mass "0.9848"
xref: delta_composition "H(-1) N(-1) O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:42:38"
xref: date_time_modified "2006-11-09 11:42:38"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Q"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:633
name: Gln->His
def: "Gln->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=633]
xref: record_id "633"
xref: delta_mono_mass "9.000334"
xref: delta_avge_mass "9.0101"
xref: delta_composition "H(-1) C N O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:42:58"
xref: date_time_modified "2006-11-09 11:42:58"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Q"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:634
name: Gln->Arg
def: "Gln->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=634]
xref: record_id "634"
xref: delta_mono_mass "28.042534"
xref: delta_avge_mass "28.0565"
xref: delta_composition "H(4) C N(2) O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:43:25"
xref: date_time_modified "2006-11-09 11:43:25"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Q"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:635
name: Gln->Xle
def: "Gln->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=635]
xref: record_id "635"
xref: delta_mono_mass "-14.974514"
xref: delta_avge_mass "-14.9716"
xref: delta_composition "H(3) C N(-1) O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:43:47"
xref: date_time_modified "2011-06-21 15:09:23"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Q"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:636
name: Arg->Ser
def: "Arg->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=636]
xref: record_id "636"
xref: delta_mono_mass "-69.069083"
xref: delta_avge_mass "-69.1084"
xref: delta_composition "H(-7) C(-3) N(-3) O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:44:13"
xref: date_time_modified "2006-11-09 11:44:13"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:637
name: Arg->Trp
def: "Arg->Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=637]
xref: record_id "637"
xref: delta_mono_mass "29.978202"
xref: delta_avge_mass "30.0242"
xref: delta_composition "H(-2) C(5) N(-2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:44:36"
xref: date_time_modified "2006-11-09 11:44:36"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:638
name: Arg->Thr
def: "Arg->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=638]
xref: record_id "638"
xref: delta_mono_mass "-55.053433"
xref: delta_avge_mass "-55.0818"
xref: delta_composition "H(-5) C(-2) N(-3) O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:44:59"
xref: date_time_modified "2006-11-09 11:44:59"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:639
name: Arg->Pro
def: "Arg->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=639]
xref: record_id "639"
xref: delta_mono_mass "-59.048347"
xref: delta_avge_mass "-59.0705"
xref: delta_composition "H(-5) C(-1) N(-3)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:45:18"
xref: date_time_modified "2006-11-09 11:45:18"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:640
name: Arg->Lys
def: "Arg->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=640]
xref: record_id "640"
xref: delta_mono_mass "-28.006148"
xref: delta_avge_mass "-28.0134"
xref: delta_composition "N(-2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:45:37"
xref: date_time_modified "2006-11-09 11:45:37"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:641
name: Arg->His
def: "Arg->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=641]
xref: record_id "641"
xref: delta_mono_mass "-19.042199"
xref: delta_avge_mass "-19.0464"
xref: delta_composition "H(-5) N(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:45:56"
xref: date_time_modified "2006-11-09 11:45:56"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:642
name: Arg->Gln
def: "Arg->Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=642]
xref: record_id "642"
xref: delta_mono_mass "-28.042534"
xref: delta_avge_mass "-28.0565"
xref: delta_composition "H(-4) C(-1) N(-2) O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:46:17"
xref: date_time_modified "2006-11-09 11:46:17"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:643
name: Arg->Met
def: "Arg->Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=643]
xref: record_id "643"
xref: delta_mono_mass "-25.060626"
xref: delta_avge_mass "-24.9896"
xref: delta_composition "H(-3) C(-1) N(-3) S"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:46:37"
xref: date_time_modified "2006-11-09 11:46:37"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:644
name: Arg->Cys
def: "Arg->Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=644]
xref: record_id "644"
xref: delta_mono_mass "-53.091927"
xref: delta_avge_mass "-53.0428"
xref: delta_composition "H(-7) C(-3) N(-3) S"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:47:00"
xref: date_time_modified "2006-11-09 11:47:00"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:645
name: Arg->Xle
def: "Arg->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=645]
xref: record_id "645"
xref: delta_mono_mass "-43.017047"
xref: delta_avge_mass "-43.0280"
xref: delta_composition "H(-1) N(-3)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:47:36"
xref: date_time_modified "2011-06-21 15:09:05"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:646
name: Arg->Gly
def: "Arg->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=646]
xref: record_id "646"
xref: delta_mono_mass "-99.079647"
xref: delta_avge_mass "-99.1344"
xref: delta_composition "H(-9) C(-4) N(-3)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 11:48:00"
xref: date_time_modified "2006-11-09 11:48:00"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:647
name: Ser->Phe
def: "Ser->Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=647]
xref: record_id "647"
xref: delta_mono_mass "60.036386"
xref: delta_avge_mass "60.0966"
xref: delta_composition "H(4) C(6) O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:32:55"
xref: date_time_modified "2006-11-09 12:32:55"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:648
name: Ser->Ala
def: "Ser->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=648]
xref: record_id "648"
xref: delta_mono_mass "-15.994915"
xref: delta_avge_mass "-15.9994"
xref: delta_composition "O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:33:14"
xref: date_time_modified "2006-11-09 12:33:14"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:649
name: Ser->Trp
def: "Ser->Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=649]
xref: record_id "649"
xref: delta_mono_mass "99.047285"
xref: delta_avge_mass "99.1326"
xref: delta_composition "H(5) C(8) N O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:33:32"
xref: date_time_modified "2006-11-09 12:33:32"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:650
name: Ser->Thr
def: "Ser->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=650]
xref: record_id "650"
xref: delta_mono_mass "14.015650"
xref: delta_avge_mass "14.0266"
xref: delta_composition "H(2) C"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:33:51"
xref: date_time_modified "2006-11-09 12:33:51"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:651
name: Ser->Asn
def: "Ser->Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=651]
xref: record_id "651"
xref: delta_mono_mass "27.010899"
xref: delta_avge_mass "27.0253"
xref: delta_composition "H C N"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:34:12"
xref: date_time_modified "2006-11-09 12:34:12"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:652
name: Ser->Pro
def: "Ser->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=652]
xref: record_id "652"
xref: delta_mono_mass "10.020735"
xref: delta_avge_mass "10.0379"
xref: delta_composition "H(2) C(2) O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:34:34"
xref: date_time_modified "2006-11-09 12:34:34"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:653
name: Ser->Tyr
def: "Ser->Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=653]
xref: record_id "653"
xref: delta_mono_mass "76.031300"
xref: delta_avge_mass "76.0960"
xref: delta_composition "H(4) C(6)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:35:00"
xref: date_time_modified "2006-11-09 12:35:00"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:654
name: Ser->Cys
def: "Ser->Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=654]
xref: record_id "654"
xref: delta_mono_mass "15.977156"
xref: delta_avge_mass "16.0656"
xref: delta_composition "O(-1) S"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:35:22"
xref: date_time_modified "2006-11-09 12:35:22"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:655
name: Ser->Arg
def: "Ser->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=655]
xref: record_id "655"
xref: delta_mono_mass "69.069083"
xref: delta_avge_mass "69.1084"
xref: delta_composition "H(7) C(3) N(3) O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:35:40"
xref: date_time_modified "2006-11-09 12:35:40"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:656
name: Ser->Xle
def: "Ser->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=656]
xref: record_id "656"
xref: delta_mono_mass "26.052036"
xref: delta_avge_mass "26.0803"
xref: delta_composition "H(6) C(3) O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:36:10"
xref: date_time_modified "2011-06-21 15:08:47"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:657
name: Ser->Gly
def: "Ser->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=657]
xref: record_id "657"
xref: delta_mono_mass "-30.010565"
xref: delta_avge_mass "-30.0260"
xref: delta_composition "H(-2) C(-1) O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:36:34"
xref: date_time_modified "2006-11-09 12:36:34"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:658
name: Thr->Ser
def: "Thr->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=658]
xref: record_id "658"
xref: delta_mono_mass "-14.015650"
xref: delta_avge_mass "-14.0266"
xref: delta_composition "H(-2) C(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:36:57"
xref: date_time_modified "2006-11-09 12:36:57"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "T"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:659
name: Thr->Ala
def: "Thr->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=659]
xref: record_id "659"
xref: delta_mono_mass "-30.010565"
xref: delta_avge_mass "-30.0260"
xref: delta_composition "H(-2) C(-1) O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:37:15"
xref: date_time_modified "2006-11-09 12:37:15"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "T"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:660
name: Thr->Asn
def: "Thr->Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=660]
xref: record_id "660"
xref: delta_mono_mass "12.995249"
xref: delta_avge_mass "12.9988"
xref: delta_composition "H(-1) N"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:37:37"
xref: date_time_modified "2006-11-09 12:37:37"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "T"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:661
name: Thr->Lys
def: "Thr->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=661]
xref: record_id "661"
xref: delta_mono_mass "27.047285"
xref: delta_avge_mass "27.0684"
xref: delta_composition "H(5) C(2) N O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:37:55"
xref: date_time_modified "2006-11-09 12:37:55"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "T"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:662
name: Thr->Pro
def: "Thr->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=662]
xref: record_id "662"
xref: delta_mono_mass "-3.994915"
xref: delta_avge_mass "-3.9887"
xref: delta_composition "C O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:38:14"
xref: date_time_modified "2006-11-09 12:38:14"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "T"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:663
name: Thr->Met
def: "Thr->Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=663]
xref: record_id "663"
xref: delta_mono_mass "29.992806"
xref: delta_avge_mass "30.0922"
xref: delta_composition "H(2) C O(-1) S"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:38:34"
xref: date_time_modified "2006-11-09 12:38:34"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "T"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:664
name: Thr->Xle
def: "Thr->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=664]
xref: record_id "664"
xref: delta_mono_mass "12.036386"
xref: delta_avge_mass "12.0538"
xref: delta_composition "H(4) C(2) O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:38:56"
xref: date_time_modified "2011-06-21 15:25:44"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "T"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:665
name: Thr->Arg
def: "Thr->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=665]
xref: record_id "665"
xref: delta_mono_mass "55.053433"
xref: delta_avge_mass "55.0818"
xref: delta_composition "H(5) C(2) N(3) O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:39:14"
xref: date_time_modified "2006-11-09 12:39:14"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "T"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:666
name: Val->Phe
def: "Val->Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=666]
xref: record_id "666"
xref: delta_mono_mass "48.000000"
xref: delta_avge_mass "48.0428"
xref: delta_composition "C(4)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:39:35"
xref: date_time_modified "2006-11-09 12:39:35"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "V"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:667
name: Val->Ala
def: "Val->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=667]
xref: record_id "667"
xref: delta_mono_mass "-28.031300"
xref: delta_avge_mass "-28.0532"
xref: delta_composition "H(-4) C(-2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:40:00"
xref: date_time_modified "2006-11-09 12:40:00"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "V"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:668
name: Val->Glu
def: "Val->Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=668]
xref: record_id "668"
xref: delta_mono_mass "29.974179"
xref: delta_avge_mass "29.9829"
xref: delta_composition "H(-2) O(2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:40:19"
xref: date_time_modified "2006-11-09 12:40:19"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "V"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:669
name: Val->Met
def: "Val->Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=669]
xref: record_id "669"
xref: delta_mono_mass "31.972071"
xref: delta_avge_mass "32.0650"
xref: delta_composition "S"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:40:36"
xref: date_time_modified "2006-11-09 12:40:36"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "V"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:670
name: Val->Asp
def: "Val->Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=670]
xref: record_id "670"
xref: delta_mono_mass "15.958529"
xref: delta_avge_mass "15.9563"
xref: delta_composition "H(-4) C(-1) O(2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:41:04"
xref: date_time_modified "2006-11-09 12:41:04"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "V"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:671
name: Val->Xle
def: "Val->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=671]
xref: record_id "671"
xref: delta_mono_mass "14.015650"
xref: delta_avge_mass "14.0266"
xref: delta_composition "H(2) C"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:41:27"
xref: date_time_modified "2011-06-21 15:08:28"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "V"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:672
name: Val->Gly
def: "Val->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=672]
xref: record_id "672"
xref: delta_mono_mass "-42.046950"
xref: delta_avge_mass "-42.0797"
xref: delta_composition "H(-6) C(-3)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:41:45"
xref: date_time_modified "2006-11-09 12:41:45"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "V"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:673
name: Trp->Ser
def: "Trp->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=673]
xref: record_id "673"
xref: delta_mono_mass "-99.047285"
xref: delta_avge_mass "-99.1326"
xref: delta_composition "H(-5) C(-8) N(-1) O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:42:22"
xref: date_time_modified "2006-11-09 12:42:22"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "W"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:674
name: Trp->Cys
def: "Trp->Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=674]
xref: record_id "674"
xref: delta_mono_mass "-83.070128"
xref: delta_avge_mass "-83.0670"
xref: delta_composition "H(-5) C(-8) N(-1) S"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:42:46"
xref: date_time_modified "2006-11-09 12:42:46"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "W"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:675
name: Trp->Arg
def: "Trp->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=675]
xref: record_id "675"
xref: delta_mono_mass "-29.978202"
xref: delta_avge_mass "-30.0242"
xref: delta_composition "H(2) C(-5) N(2)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:43:10"
xref: date_time_modified "2006-11-09 12:43:10"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "W"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:676
name: Trp->Gly
def: "Trp->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=676]
xref: record_id "676"
xref: delta_mono_mass "-129.057849"
xref: delta_avge_mass "-129.1586"
xref: delta_composition "H(-7) C(-9) N(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:43:29"
xref: date_time_modified "2006-11-09 12:43:29"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "W"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:677
name: Trp->Xle
def: "Trp->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=677]
xref: record_id "677"
xref: delta_mono_mass "-72.995249"
xref: delta_avge_mass "-73.0523"
xref: delta_composition "H C(-5) N(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:43:49"
xref: date_time_modified "2011-06-21 15:08:09"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "W"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:678
name: Tyr->Phe
def: "Tyr->Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=678]
xref: record_id "678"
xref: delta_mono_mass "-15.994915"
xref: delta_avge_mass "-15.9994"
xref: delta_composition "O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:44:13"
xref: date_time_modified "2006-11-09 12:44:13"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Y"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:679
name: Tyr->Ser
def: "Tyr->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=679]
xref: record_id "679"
xref: delta_mono_mass "-76.031300"
xref: delta_avge_mass "-76.0960"
xref: delta_composition "H(-4) C(-6)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:44:37"
xref: date_time_modified "2006-11-09 12:44:37"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Y"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:680
name: Tyr->Asn
def: "Tyr->Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=680]
xref: record_id "680"
xref: delta_mono_mass "-49.020401"
xref: delta_avge_mass "-49.0706"
xref: delta_composition "H(-3) C(-5) N"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:44:59"
xref: date_time_modified "2006-11-09 12:44:59"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Y"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:681
name: Tyr->His
def: "Tyr->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=681]
xref: record_id "681"
xref: delta_mono_mass "-26.004417"
xref: delta_avge_mass "-26.0340"
xref: delta_composition "H(-2) C(-3) N(2) O(-1)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:45:22"
xref: date_time_modified "2006-11-09 12:45:22"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Y"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:682
name: Tyr->Asp
def: "Tyr->Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=682]
xref: record_id "682"
xref: delta_mono_mass "-48.036386"
xref: delta_avge_mass "-48.0859"
xref: delta_composition "H(-4) C(-5) O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:45:44"
xref: date_time_modified "2006-11-09 12:45:44"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Y"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:683
name: Tyr->Cys
def: "Tyr->Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=683]
xref: record_id "683"
xref: delta_mono_mass "-60.054144"
xref: delta_avge_mass "-60.0304"
xref: delta_composition "H(-4) C(-6) O(-1) S"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-09 12:46:03"
xref: date_time_modified "2006-11-09 12:46:03"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Y"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "AA substitution"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:684
name: BDMAPP
def: "Mass Defect Tag on lysine e-amino." [URL:http\://www.targetdiscovery.com/article.php?topic=crpc.prst&story=20060321132643690, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=684]
xref: record_id "684"
xref: delta_mono_mass "253.010225"
xref: delta_avge_mass "254.1231"
xref: delta_composition "H(12) C(11) N O Br"
xref: username_of_poster "LVSchneid"
xref: group_of_poster ""
xref: date_time_posted "2006-11-13 18:51:11"
xref: date_time_modified "2006-11-13 18:52:47"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "H"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_1_misc_notes "Low efficiency"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N-term"
xref: spec_3_position "Protein N-term"
xref: spec_3_classification "Chemical derivative"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "Y"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Artefact"
xref: spec_4_misc_notes "Low efficiency"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "W"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Artefact"
xref: spec_5_misc_notes "Low efficiency"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:685
name: NA-LNO2
def: "Nitroalkylation by Nitro Linoleic Acid." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=685]
comment: Reversible post-translational modification of proteins by nitrated fatty acids.
synonym: "Michael addition of nitro-linoleic acid to Cys and His" []
xref: record_id "685"
xref: delta_mono_mass "325.225309"
xref: delta_avge_mass "325.4430"
xref: delta_composition "H(31) C(18) N O(4)"
xref: username_of_poster "cbatthya"
xref: group_of_poster ""
xref: date_time_posted "2006-11-13 18:59:35"
xref: date_time_modified "2006-11-13 18:59:35"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "H"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:686
name: NA-OA-NO2
def: "Nitroalkylation by Nitro Oleic Acid." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=686]
comment: Reversible post-translational modification of proteins by nitrated fatty acids.
synonym: "Michael addition of nitro-oleic acid to Cys and His" []
xref: record_id "686"
xref: delta_mono_mass "327.240959"
xref: delta_avge_mass "327.4589"
xref: delta_composition "H(33) C(18) N O(4)"
xref: username_of_poster "cbatthya"
xref: group_of_poster ""
xref: date_time_posted "2006-11-13 19:01:33"
xref: date_time_modified "2006-11-13 19:01:33"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "H"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:687
name: ICPL:2H(4)
def: "Bruker Daltonics SERVA-ICPL(TM) quantification chemistry, medium form." [URL:http\://www.bdal.de/life-science-tools/care-consumables-more/icpl-kit.html, PMID:15602776, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=687]
comment: Attention: As the digest is typically applied AFTER ICPL_light/heavy labeling, only ProteinN-term labeling and Lys-specific labeling is applied.
xref: record_id "687"
xref: delta_mono_mass "109.046571"
xref: delta_avge_mass "109.1188"
xref: delta_composition "H(-1) 2H(4) C(6) N O"
xref: username_of_poster "suckau"
xref: group_of_poster ""
xref: date_time_posted "2006-11-13 19:05:12"
xref: date_time_modified "2008-09-03 15:26:54"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "0"
xref: spec_2_site "N-term"
xref: spec_2_position "Protein N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_2_misc_notes "Use when labelling pre-digest"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N-term"
xref: spec_3_position "Any N-term"
xref: spec_3_classification "Isotopic label"
xref: spec_3_misc_notes "Use when labelling post-digest"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:695
name: Label:13C(6)15N(1)
def: "13C(6) 15N(1) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=695]
xref: record_id "695"
xref: delta_mono_mass "7.017164"
xref: delta_avge_mass "6.9493"
xref: delta_composition "C(-6) 13C(6) N(-1) 15N"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2006-11-29 15:10:53"
xref: date_time_modified "2007-08-22 18:30:49"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "L"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "I"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:696
name: Label:2H(9)13C(6)15N(2)
def: "13C(6) 15N(2) (D)9 SILAC label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, URL:http\://www.isotope.com/cil/products/displayproduct.cfm?prod_id=8635, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=696]
synonym: "heavy D9 lysine" []
xref: record_id "696"
xref: delta_mono_mass "17.070690"
xref: delta_avge_mass "16.9982"
xref: delta_composition "H(-9) 2H(9) C(-6) 13C(6) N(-2) 15N(2)"
xref: username_of_poster "striker2000"
xref: group_of_poster ""
xref: date_time_posted "2006-12-01 22:36:25"
xref: date_time_modified "2007-08-22 18:48:35"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_1_misc_notes "Used in SILAC experiment"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:697
name: NIC
def: "Nicotinic Acid." [PMID:15004565, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=697]
xref: record_id "697"
xref: delta_mono_mass "105.021464"
xref: delta_avge_mass "105.0941"
xref: delta_composition "H(3) C(6) N O"
xref: username_of_poster "verena-meyer"
xref: group_of_poster ""
xref: date_time_posted "2006-12-04 16:04:56"
xref: date_time_modified "2006-12-09 17:31:30"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N-term"
xref: spec_1_position "Any N-term"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:698
name: dNIC
def: "Deuterated Nicotinic Acid." [PMID:15004565, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=698]
xref: record_id "698"
xref: delta_mono_mass "109.048119"
xref: delta_avge_mass "109.1205"
xref: delta_composition "H 2H(3) C(6) N O"
xref: username_of_poster "verena-meyer"
xref: group_of_poster ""
xref: date_time_posted "2006-12-04 16:12:54"
xref: date_time_modified "2006-12-09 17:32:46"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N-term"
xref: spec_1_position "Any N-term"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:720
name: HNE-Delta:H(2)O
def: "Dehydrated 4-hydroxynonenal." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=720]
comment: Mass Spectroscopic Characterization of Protein Modification by 4-Hydroxy-2-(E)-nonenal and 4-Oxo-2-(E)-nonenal.
xref: record_id "720"
xref: delta_mono_mass "138.104465"
xref: delta_avge_mass "138.2069"
xref: delta_composition "H(14) C(9) O"
xref: username_of_poster "stewartb"
xref: group_of_poster ""
xref: date_time_posted "2007-01-08 18:29:46"
xref: date_time_modified "2007-01-21 18:27:18"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "H"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "K"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:721
name: 4-ONE
def: "4-Oxononenal (ONE)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=721]
comment: Covalent adduction of nucleophilic amino acids by 4-hydroxynonenal and 4-oxononenal.
xref: record_id "721"
xref: delta_mono_mass "154.099380"
xref: delta_avge_mass "154.2063"
xref: delta_composition "H(14) C(9) O(2)"
xref: username_of_poster "stewartb"
xref: group_of_poster ""
xref: date_time_posted "2007-01-08 19:41:28"
xref: date_time_modified "2007-01-21 18:26:54"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "H"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "K"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:723
name: O-Dimethylphosphate
def: "O-Dimethylphosphorylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=723]
xref: record_id "723"
xref: delta_mono_mass "107.997631"
xref: delta_avge_mass "108.0331"
xref: delta_composition "H(5) C(2) O(3) P"
xref: username_of_poster "lmschopfer"
xref: group_of_poster ""
xref: date_time_posted "2007-01-09 21:25:28"
xref: date_time_modified "2007-01-13 21:01:15"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:724
name: O-Methylphosphate
def: "O-Methylphosphorylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=724]
comment: Created by auto-catalytic dealkylation of the O-Dimethylphosphate adduct.
xref: record_id "724"
xref: delta_mono_mass "93.981981"
xref: delta_avge_mass "94.0065"
xref: delta_composition "H(3) C O(3) P"
xref: username_of_poster "lmschopfer"
xref: group_of_poster ""
xref: date_time_posted "2007-01-09 21:35:38"
xref: date_time_modified "2007-01-21 18:13:01"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:725
name: Diethylphosphate
def: "O-Diethylphosphorylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=725]
xref: record_id "725"
xref: delta_mono_mass "136.028931"
xref: delta_avge_mass "136.0862"
xref: delta_composition "H(9) C(4) O(3) P"
xref: username_of_poster "lmschopfer"
xref: group_of_poster ""
xref: date_time_posted "2007-01-09 21:44:04"
xref: date_time_modified "2011-12-05 16:15:16"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "K"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Chemical derivative"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "C"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Chemical derivative"
xref: spec_6_group "6"
xref: spec_6_hidden "1"
xref: spec_6_site "H"
xref: spec_6_position "Anywhere"
xref: spec_6_classification "Chemical derivative"
xref: spec_7_group "7"
xref: spec_7_hidden "1"
xref: spec_7_site "N-term"
xref: spec_7_position "Any N-term"
xref: spec_7_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:726
name: Ethylphosphate
def: "O-Ethylphosphorylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=726]
comment: Created by auto-catalytic dealkylation of the O-Diethylphosphate adduct.
xref: record_id "726"
xref: delta_mono_mass "107.997631"
xref: delta_avge_mass "108.0331"
xref: delta_composition "H(5) C(2) O(3) P"
xref: username_of_poster "lmschopfer"
xref: group_of_poster ""
xref: date_time_posted "2007-01-09 21:46:17"
xref: date_time_modified "2011-12-05 16:15:47"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "K"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Chemical derivative"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "N-term"
xref: spec_5_position "Any N-term"
xref: spec_5_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:727
name: O-pinacolylmethylphosphonate
def: "O-pinacolylmethylphosphonylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=727]
xref: record_id "727"
xref: delta_mono_mass "162.080967"
xref: delta_avge_mass "162.1666"
xref: delta_composition "H(15) C(7) O(2) P"
xref: username_of_poster "lmschopfer"
xref: group_of_poster ""
xref: date_time_posted "2007-01-10 16:04:46"
xref: date_time_modified "2010-04-29 08:38:50"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "H"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Chemical derivative"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "K"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:728
name: Methylphosphonate
def: "Methylphosphonylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=728]
comment: Created by auto-catalytic dealkylation of either the O-pinacolylmethylphosphonate adduct, or the O-isopropylmethylphosphonate adduct.
xref: record_id "728"
xref: delta_mono_mass "77.987066"
xref: delta_avge_mass "78.0071"
xref: delta_composition "H(3) C O(2) P"
xref: username_of_poster "lmschopfer"
xref: group_of_poster ""
xref: date_time_posted "2007-01-10 16:07:37"
xref: date_time_modified "2007-01-21 18:11:36"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:729
name: O-Isopropylmethylphosphonate
def: "O-Isopropylmethylphosphonylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=729]
xref: record_id "729"
xref: delta_mono_mass "120.034017"
xref: delta_avge_mass "120.0868"
xref: delta_composition "H(9) C(4) O(2) P"
xref: username_of_poster "lmschopfer"
xref: group_of_poster ""
xref: date_time_posted "2007-01-10 16:10:55"
xref: date_time_modified "2007-01-13 21:02:02"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:730
name: iTRAQ8plex
def: "Representative mass and accurate mass for 113, 114, 116 & 117." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=730]
comment: Other 4 channels have the same nominal mass but slightly different exact mass. For quantitation purposes, use this entry for all channels.
synonym: "Applied Biosystems iTRAQ(TM) multiplexed quantitation chemistry AKA iTRAQ8plex:13C(7)15N(1)" []
xref: record_id "730"
xref: delta_mono_mass "304.205360"
xref: delta_avge_mass "304.3074"
xref: delta_composition "H(24) C(7) 13C(7) N(3) 15N O(3)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2007-01-11 09:53:13"
xref: date_time_modified "2011-11-21 14:10:21"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "0"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_3_group "3"
xref: spec_3_hidden "0"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Isotopic label"
xref: spec_3_misc_notes "Low abundance"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "H"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Isotopic label"
xref: spec_4_misc_notes "Very low abundance"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "S"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Isotopic label"
xref: spec_5_misc_notes "Very low abundance"
xref: spec_6_group "6"
xref: spec_6_hidden "1"
xref: spec_6_site "T"
xref: spec_6_position "Anywhere"
xref: spec_6_classification "Isotopic label"
xref: spec_6_misc_notes "Very low abundance"
xref: spec_7_group "7"
xref: spec_7_hidden "1"
xref: spec_7_site "N-term"
xref: spec_7_position "Protein N-term"
xref: spec_7_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:731
name: iTRAQ8plex:13C(6)15N(2)
def: "Accurate mass for 115, 118, 119 & 121." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=731]
comment: Other 4 channels have the same nominal mass but slightly different exact mass. For quantitation purposes, use iTRAQ8plex for all channels.
synonym: "Applied Biosystems iTRAQ(TM) multiplexed quantitation chemistry" []
xref: record_id "731"
xref: delta_mono_mass "304.199040"
xref: delta_avge_mass "304.3081"
xref: delta_composition "H(24) C(8) 13C(6) N(2) 15N(2) O(3)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2007-01-11 09:56:21"
xref: date_time_modified "2007-01-13 20:59:54"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Isotopic label"
xref: spec_3_misc_notes "Low abundance"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:734
name: Ethanolamine
def: "Carboxyl modification with ethanolamine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=734]
comment: Carbodiimide mediated blocking of free carboxylic acids (Asp/Glu sidechains and C-termini) with ethanolamine; reaction yields an amide-bond between the carboxylic acid of the peptide/protein and the primary amine of ethanolamine; reaction irreversibly modifies carboxylic acids. Shown above is the composition of the mass adduct, after substraction of water.
xref: record_id "734"
xref: delta_mono_mass "43.042199"
xref: delta_avge_mass "43.0678"
xref: delta_composition "H(5) C(2) N"
xref: username_of_poster "overalllab"
xref: group_of_poster ""
xref: date_time_posted "2007-01-31 22:04:44"
xref: date_time_modified "2007-02-11 19:39:59"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C-term"
xref: spec_1_position "Any C-term"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "D"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "E"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:735
name: DTT_ST
def: "Dithiothreitol (DTT)." [PMID:17116471, PMID:12438562, PMID:15648052, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=735]
comment: Beta-elimination and Michael addition of dithiothreitol (DTT) to serine and threonine adds a weight of approximately 136.2.
synonym: "threo-1,4-dimercaptobutane-2,3-diol Cleland's reagent" []
xref: record_id "735"
xref: delta_mono_mass "136.001656"
xref: delta_avge_mass "136.2357"
xref: delta_composition "H(8) C(4) O S(2)"
xref: username_of_poster "stephenaw777"
xref: group_of_poster ""
xref: date_time_posted "2007-02-10 00:00:43"
xref: date_time_modified "2007-02-11 19:39:11"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_1_misc_notes "The addition of DTT adds 136.2 not 154.2 to Serine due to loss of water in reaction"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_2_misc_notes "The addition of DTT adds 136.2 not 154.2 to Threonine due to loss of water in reaction"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:736
name: DTT_C
def: "Dithiothreitol (DTT) on Cys." [PMID:17116471, PMID:16452088, PMID:12438562, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=736]
comment: When the beta-elimination and Michael addition of dithiothreitol (DTT) (BEMAD) reaction is used with alkylated cysteine a sulfur group is lost leaving the addition of approximately 120.2 in the chemical reaction.
synonym: "Cleland's reagent" []
xref: record_id "736"
xref: delta_mono_mass "120.024500"
xref: delta_avge_mass "120.1701"
xref: delta_composition "H(8) C(4) O(2) S"
xref: username_of_poster "stephenaw777"
xref: group_of_poster ""
xref: date_time_posted "2007-02-10 03:12:41"
xref: date_time_modified "2007-02-11 19:38:59"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:737
name: TMT6plex
def: "Sixplex Tandem Mass Tag®." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=737]
comment: Sixplex-TMT® reagents 6TMT-126, 6TMT-127, 6TMT-128, 6TMT-129, 6TMT-130, 6TMT-131 Masses of the TMT® fragment ions to be quantified:126.1283 127.1316 128.1350 129.1383 130.1417 131.1387.
synonym: "Tandem Mass Tag® and TMT® are registered Trademarks of Proteome Sciences plc. Tandem Mass Tag sixplex labelling kit Proteome Sciences" []
xref: record_id "737"
xref: delta_mono_mass "229.162932"
xref: delta_avge_mass "229.2634"
xref: delta_composition "H(20) C(8) 13C(4) N 15N O(2)"
xref: username_of_poster "JUergen.schaefer"
xref: group_of_poster ""
xref: date_time_posted "2007-03-01 13:44:23"
xref: date_time_modified "2011-11-25 11:11:19"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "0"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N-term"
xref: spec_3_position "Protein N-term"
xref: spec_3_classification "Isotopic label"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "H"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Isotopic label"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "S"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Isotopic label"
xref: spec_6_group "6"
xref: spec_6_hidden "1"
xref: spec_6_site "T"
xref: spec_6_position "Anywhere"
xref: spec_6_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:738
name: TMT2plex
def: "Duplex Tandem Mass Tag®." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=738]
comment: Duplex-TMT® reagents 2TMT-126, 2TMT-127 Masses of the TMT® fragment ions to be quantified: 126.1283 127.1316.
synonym: "Tandem Mass Tag Duplex labelling kit Proteome Sciences Tandem Mass Tag® and TMT® are registered Trademarks of Proteome Sciences plc." []
xref: record_id "738"
xref: delta_mono_mass "225.155833"
xref: delta_avge_mass "225.2921"
xref: delta_composition "H(20) C(11) 13C N(2) O(2)"
xref: username_of_poster "JUergen.schaefer"
xref: group_of_poster ""
xref: date_time_posted "2007-03-01 13:53:36"
xref: date_time_modified "2011-11-25 11:12:57"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "0"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N-term"
xref: spec_3_position "Protein N-term"
xref: spec_3_classification "Isotopic label"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "H"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Isotopic label"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "S"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Isotopic label"
xref: spec_6_group "6"
xref: spec_6_hidden "1"
xref: spec_6_site "T"
xref: spec_6_position "Anywhere"
xref: spec_6_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:739
name: TMT
def: "Native Tandem Mass Tag®." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=739]
comment: This modification describes the \"native\" TMT Reagent without isotopic label.
synonym: "Tandem Mass Tag® and TMT® are registered Trademarks of Proteome Sciences plc." []
xref: record_id "739"
xref: delta_mono_mass "224.152478"
xref: delta_avge_mass "224.2994"
xref: delta_composition "H(20) C(12) N(2) O(2)"
xref: username_of_poster "JUergen.schaefer"
xref: group_of_poster ""
xref: date_time_posted "2007-03-02 09:29:50"
xref: date_time_modified "2011-11-25 11:15:14"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N-term"
xref: spec_3_position "Protein N-term"
xref: spec_3_classification "Chemical derivative"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "H"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Isotopic label"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "S"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Isotopic label"
xref: spec_6_group "6"
xref: spec_6_hidden "1"
xref: spec_6_site "T"
xref: spec_6_position "Anywhere"
xref: spec_6_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:740
name: ExacTagThiol
def: "ExacTag Thiol label mass for 2-4-7-10 plex." [URL:http\://www.perkinelmer.com/exactag, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=740]
comment: Accurate mass for Exactag Thiol labels.
synonym: "PerkinElmer ExacTag Thiol kit" []
xref: record_id "740"
xref: delta_mono_mass "972.365219"
xref: delta_avge_mass "972.7268"
xref: delta_composition "H(50) C(23) 13C(12) N(8) 15N(6) O(18)"
xref: username_of_poster "cparman"
xref: group_of_poster ""
xref: date_time_posted "2007-03-02 17:24:48"
xref: date_time_modified "2007-03-03 18:28:20"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:741
name: ExacTagAmine
def: "ExacTag Amine label mass for 2-4-7-10 plex." [URL:http\://www.perkinelmer.com/exactag, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=741]
comment: Accurate mass for Exactag Amine labels. Includes the mass of the conjugation reagent.
synonym: "PerkinElmer ExacTag Amine kit" []
xref: record_id "741"
xref: delta_mono_mass "1046.347854"
xref: delta_avge_mass "1046.8285"
xref: delta_composition "H(52) C(25) 13C(12) N(8) 15N(6) O(19) S"
xref: username_of_poster "cparman"
xref: group_of_poster ""
xref: date_time_posted "2007-03-02 17:28:02"
xref: date_time_modified "2007-05-02 14:15:44"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:743
name: 4-ONE+Delta:H(-2)O(-1)
def: "Dehydrated 4-Oxononenal Michael adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=743]
comment: Mass Spectorscopic Characterization of Protein Modification by 4-hydroxy-2-(E)-nonenal and 4-oxo-2-(E)-nonenal.
xref: record_id "743"
xref: delta_mono_mass "136.088815"
xref: delta_avge_mass "136.1910"
xref: delta_composition "H(12) C(9) O"
xref: username_of_poster "stewartb"
xref: group_of_poster ""
xref: date_time_posted "2007-03-21 21:21:34"
xref: date_time_modified "2007-04-08 18:56:36"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "H"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "K"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:744
name: NO_SMX_SEMD
def: "Nitroso Sulfamethoxazole Sulphenamide thiol adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=744]
comment: Synthesis and Reactions of Nitroso Sulphamethoxazole with Biological Nucleophiles: Implications for Immune Mediated Toxicity.
xref: record_id "744"
xref: delta_mono_mass "252.044287"
xref: delta_avge_mass "252.2697"
xref: delta_composition "H(10) C(10) N(3) O(3) S"
xref: username_of_poster "stewartb"
xref: group_of_poster ""
xref: date_time_posted "2007-04-17 23:28:29"
xref: date_time_modified "2007-04-21 16:55:48"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:745
name: NO_SMX_SMCT
def: "Nitroso Sulfamethoxazole semimercaptal thiol adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=745]
comment: Synthesis and Reactions of Nitroso Sulphamethoxazole with Biological Nucleophiles: Implications for Immune Mediated Toxicity.
xref: record_id "745"
xref: delta_mono_mass "268.039202"
xref: delta_avge_mass "268.2691"
xref: delta_composition "H(10) C(10) N(3) O(4) S"
xref: username_of_poster "stewartb"
xref: group_of_poster ""
xref: date_time_posted "2007-04-18 21:37:48"
xref: date_time_modified "2007-04-21 16:56:19"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:746
name: NO_SMX_SIMD
def: "Nitroso Sulfamethoxazole Sulfinamide thiol adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=746]
comment: Synthesis and Reactions of Nitroso Sulphamethoxazole with Biological Nucleophiles: Implications for Immune Mediated Toxicity.
xref: record_id "746"
xref: delta_mono_mass "267.031377"
xref: delta_avge_mass "267.2612"
xref: delta_composition "H(9) C(10) N(3) O(4) S"
xref: username_of_poster "stewartb"
xref: group_of_poster ""
xref: date_time_posted "2007-04-18 21:39:11"
xref: date_time_modified "2007-04-21 16:56:07"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:747
name: Malonyl
def: "Malonylation of C and S residues." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=747]
xref: record_id "747"
xref: delta_mono_mass "86.000394"
xref: delta_avge_mass "86.0462"
xref: delta_composition "H(2) C(3) O(3)"
xref: username_of_poster "massy"
xref: group_of_poster ""
xref: date_time_posted "2007-05-17 14:17:42"
xref: date_time_modified "2007-05-25 18:34:43"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "S"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:748
name: 3sulfo
def: "Derivatization by N-term modification using 3-Sulfobenzoic succinimidyl ester." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=748]
xref: record_id "748"
xref: delta_mono_mass "183.983029"
xref: delta_avge_mass "184.1693"
xref: delta_composition "H(4) C(7) O(4) S"
xref: username_of_poster "MaxWis"
xref: group_of_poster ""
xref: date_time_posted "2007-05-31 10:15:48"
xref: date_time_modified "2007-06-24 19:58:07"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N-term"
xref: spec_1_position "Any N-term"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:750
name: trifluoro
def: "Trifluoroleucine replacement of leucine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=750]
xref: record_id "750"
xref: delta_mono_mass "53.971735"
xref: delta_avge_mass "53.9714"
xref: delta_composition "H(-3) F(3)"
xref: username_of_poster "UKMSF"
xref: group_of_poster ""
xref: date_time_posted "2007-06-13 17:10:33"
xref: date_time_modified "2007-06-24 19:56:32"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "L"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Non-standard residue"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:751
name: TNBS
def: "Tri nitro benzene." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=751]
xref: record_id "751"
xref: delta_mono_mass "210.986535"
xref: delta_avge_mass "211.0886"
xref: delta_composition "H C(6) N(3) O(6)"
xref: username_of_poster "DelphineP"
xref: group_of_poster ""
xref: date_time_posted "2007-06-21 13:36:03"
xref: date_time_modified "2007-06-24 19:58:58"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:762
name: IDEnT
def: "Isotope Distribution Encoded Tag." [PMID:10740847, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=762]
comment: Modified peptides identified by isotope pattern. Restriction to cysteine-containing peptides combined with high mass accuracy allows peptide identification.
synonym: "2,4-dichlorobenzylcarbamidomethyl" []
xref: record_id "762"
xref: delta_mono_mass "214.990469"
xref: delta_avge_mass "216.0640"
xref: delta_composition "H(7) C(9) N O Cl(2)"
xref: username_of_poster "chalkley"
xref: group_of_poster ""
xref: date_time_posted "2007-07-10 20:14:50"
xref: date_time_modified "2007-07-15 20:04:29"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:763
name: DTT_ST:2H(6)
def: "Isotopically labeled Dithiothreitol (DTT) modification of serines or threonines." [PMID:15648052, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=763]
comment: Can be used for quantitative analysis of O-linked post-translational modifications. Same reaction can be used for quantitative analysis of cysteine-containing peptides, but then the modification is 16 Da less in mass; i.e. isotopically labeled reagent adds 126 Da in mass.
synonym: "Cleland's reagent" []
xref: record_id "763"
xref: delta_mono_mass "142.039317"
xref: delta_avge_mass "142.2727"
xref: delta_composition "H(2) 2H(6) C(4) O S(2)"
xref: username_of_poster "chalkley"
xref: group_of_poster ""
xref: date_time_posted "2007-07-10 20:34:46"
xref: date_time_modified "2007-07-10 21:11:44"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:764
name: DTT_C:2H(6)
def: "Isotopically labeled Dithiothreitol (DTT) modification of cysteines." [PMID:15648052, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=764]
comment: Can be used for quantitative analysis of cysteine-containing peptides. Same reaction can be used for quantitative analysis of O-linked post-translational modifications to serines and threonines, but then the modification is 16 Da more in mass; i.e. isotopically labeled reagent adds 142 Da in mass.
synonym: "Cleland's reagent" []
xref: record_id "764"
xref: delta_mono_mass "126.062161"
xref: delta_avge_mass "126.2071"
xref: delta_composition "H(2) 2H(6) C(4) O(2) S"
xref: username_of_poster "chalkley"
xref: group_of_poster ""
xref: date_time_posted "2007-07-10 20:44:56"
xref: date_time_modified "2007-07-10 21:10:28"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:765
name: Met-loss
def: "Removal of initiator methionine from protein N-terminus." [PMID:3327521, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=765]
comment: N-terminal initiator methionine is removed by a methionine aminopeptidase from proteins where the residue following the methionine is Ala, Cys, Gly, Pro, Ser, Thr or Val. This is generally the final N-terminal state for proteins where the following residue was a Cys, Pro or Val.
xref: record_id "765"
xref: delta_mono_mass "-131.040485"
xref: delta_avge_mass "-131.1961"
xref: delta_composition "H(-9) C(-5) N(-1) O(-1) S(-1)"
xref: username_of_poster "chalkley"
xref: group_of_poster ""
xref: date_time_posted "2007-07-10 22:40:00"
xref: date_time_modified "2007-07-15 20:01:35"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "M"
xref: spec_1_position "Protein N-term"
xref: spec_1_classification "Co-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:766
name: Met-loss+Acetyl
def: "Removal of initiator methionine from protein N-terminus, then acetylation of the new N-terminus." [PMID:3327521, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=766]
comment: The N-terminal initiator methionine is removed by a methionine aminopeptidase from proteins whose residue following the methionine is Ala, Cys, Gly, Pro, Ser, Thr or Val. Proteins whose following residue was Ala, Gly, Ser or Thr are then acetylated by an N(alpha)-acetyltransferase on the new N-terminus.
xref: record_id "766"
xref: delta_mono_mass "-89.029920"
xref: delta_avge_mass "-89.1594"
xref: delta_composition "H(-7) C(-3) N(-1) S(-1)"
xref: username_of_poster "chalkley"
xref: group_of_poster ""
xref: date_time_posted "2007-07-10 22:57:12"
xref: date_time_modified "2007-07-15 20:01:06"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "M"
xref: spec_1_position "Protein N-term"
xref: spec_1_classification "Co-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:767
name: Menadione-HQ
def: "Menadione hydroquinone derivative." [PMID:15939799, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=767]
xref: record_id "767"
xref: delta_mono_mass "172.052430"
xref: delta_avge_mass "172.1800"
xref: delta_composition "H(8) C(11) O(2)"
xref: username_of_poster "catsriku"
xref: group_of_poster ""
xref: date_time_posted "2007-07-12 07:35:07"
xref: date_time_modified "2007-07-15 20:05:56"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:768
name: Methyl+Acetyl:2H(3)
def: "Mono-methylated lysine labelled with Acetyl_heavy." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=768]
xref: record_id "768"
xref: delta_mono_mass "59.045045"
xref: delta_avge_mass "59.0817"
xref: delta_composition "H 2H(3) C(3) O"
xref: username_of_poster "buchanan"
xref: group_of_poster ""
xref: date_time_posted "2007-08-06 09:35:40"
xref: date_time_modified "2007-09-07 16:56:17"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:771
name: lapachenole
def: "Lapachenole photochemically added to cysteine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=771]
xref: record_id "771"
xref: delta_mono_mass "240.115030"
xref: delta_avge_mass "240.2970"
xref: delta_composition "H(16) C(16) O(2)"
xref: username_of_poster "hmfales"
xref: group_of_poster ""
xref: date_time_posted "2007-08-17 22:22:15"
xref: date_time_modified "2007-09-07 16:52:37"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_1_misc_notes "Simple cyclic compound C16H16O2 adds to cysteine forming fluorescent derivative."
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:772
name: Label:13C(5)
def: "13C(5) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, PMID:12716131, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=772]
xref: record_id "772"
xref: delta_mono_mass "5.016774"
xref: delta_avge_mass "4.9633"
xref: delta_composition "C(-5) 13C(5)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2007-08-22 18:36:11"
xref: date_time_modified "2007-08-22 18:36:11"
xref: approved "1"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "P"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_1_misc_notes "Result of Arg to Pro conversion of 13C(6) labelled Arg"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:773
name: maleimide
def: "Maleimide." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=773]
xref: record_id "773"
xref: delta_mono_mass "97.016378"
xref: delta_avge_mass "97.0721"
xref: delta_composition "H(3) C(4) N O(2)"
xref: username_of_poster "mjayson"
xref: group_of_poster ""
xref: date_time_posted "2007-09-05 23:31:52"
xref: date_time_modified "2007-09-06 11:28:09"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:774
name: Biotin-phenacyl
def: "Alkylation by biotinylated form of phenacyl bromide." [PMID:428399, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=774]
comment: Phenacyl bromide conjugated with a linker and biotin tag, details not published yet.
xref: record_id "774"
xref: delta_mono_mass "626.263502"
xref: delta_avge_mass "626.7270"
xref: delta_composition "H(38) C(29) N(8) O(6) S"
xref: username_of_poster "Sandeep"
xref: group_of_poster ""
xref: date_time_posted "2007-09-14 23:07:12"
xref: date_time_modified "2007-10-03 15:42:46"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "H"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "S"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:775
name: Carboxymethyl:13C(2)
def: "Iodoacetic acid derivative w/ 13C label." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=775]
synonym: "Carboxymethylation w/ 13C label" []
xref: record_id "775"
xref: delta_mono_mass "60.012189"
xref: delta_avge_mass "60.0214"
xref: delta_composition "H(2) 13C(2) O(2)"
xref: username_of_poster "mpcusack"
xref: group_of_poster ""
xref: date_time_posted "2007-09-18 19:26:42"
xref: date_time_modified "2008-06-22 12:00:27"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:776
name: NEM:2H(5)
def: "D5 N-ethylmaleimide on cysteines." [URL:http\://www.chemistry.ucsc.edu/~fink/231/Image118.gif, PMID:12777388, PMID:11813307, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=776]
synonym: "CysNEM D5" []
xref: record_id "776"
xref: delta_mono_mass "130.079062"
xref: delta_avge_mass "130.1561"
xref: delta_composition "H(2) 2H(5) C(6) N O(2)"
xref: username_of_poster "mpcusack"
xref: group_of_poster ""
xref: date_time_posted "2007-09-18 19:49:39"
xref: date_time_modified "2007-09-28 10:37:50"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:792
name: AEC-MAEC:2H(4)
def: "Deuterium cysteamine modification to S or T." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=792]
xref: record_id "792"
xref: delta_mono_mass "63.044462"
xref: delta_avge_mass "63.1580"
xref: delta_composition "H 2H(4) C(2) N O(-1) S"
xref: username_of_poster "zwang23"
xref: group_of_poster ""
xref: date_time_posted "2007-10-03 19:41:19"
xref: date_time_modified "2007-10-08 13:44:02"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:793
name: Hex1HexNAc1
def: "Hex1HexNAc1." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=793]
xref: record_id "793"
xref: delta_mono_mass "365.132196"
xref: delta_avge_mass "365.3331"
xref: delta_composition "Hex HexNAc"
xref: username_of_poster "julienjardin"
xref: group_of_poster ""
xref: date_time_posted "2007-10-12 13:16:23"
xref: date_time_modified "2011-11-21 14:03:42"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "O-linked glycosylation"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "O-linked glycosylation"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "N"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:799
name: Label:13C(6)+GlyGly
def: "13C6 labeled ubiquitinylation residue." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=799]
comment: The two glycine residues left on SILAC labeled ubiquitinylated lysine after tryptic digestion.
xref: record_id "799"
xref: delta_mono_mass "120.063056"
xref: delta_avge_mass "120.0586"
xref: delta_composition "H(6) C(-2) 13C(6) N(2) O(2)"
xref: username_of_poster "glick2"
xref: group_of_poster ""
xref: date_time_posted "2007-12-02 22:45:39"
xref: date_time_modified "2008-11-21 18:22:05"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:800
name: Biotin:Thermo-21345
def: "Was PentylamineBiotin." [URL:http\://www.piercenet.com/Products/Browse.cfm?fldID=01031206, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=800]
synonym: "Used for labeling glutamine-donor substrate of transglutaminase" []
xref: record_id "800"
xref: delta_mono_mass "311.166748"
xref: delta_avge_mass "311.4429"
xref: delta_composition "H(25) C(15) N(3) O(2) S"
xref: username_of_poster "mengyi"
xref: group_of_poster ""
xref: date_time_posted "2007-12-03 13:56:58"
xref: date_time_modified "2010-12-03 16:06:50"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Q"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:801
name: Pentylamine
def: "Labeling transglutaminase substrate on glutamine side chain." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=801]
xref: record_id "801"
xref: delta_mono_mass "85.089149"
xref: delta_avge_mass "85.1475"
xref: delta_composition "H(11) C(5) N"
xref: username_of_poster "mengyi"
xref: group_of_poster ""
xref: date_time_posted "2007-12-05 11:08:02"
xref: date_time_modified "2007-12-14 17:52:16"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Q"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:811
name: Biotin:Thermo-21360
def: "Was Biotin-PEO4-hydrazide." [URL:http\://www.piercenet.com/products/browse.cfm?fldID=C4FE82D4-DD06-493C-8EC4-9C1D7F83211B, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=811]
synonym: "Pierce EZ link biotin hydrazide prod no. 21360" []
xref: record_id "811"
xref: delta_mono_mass "487.246455"
xref: delta_avge_mass "487.6134"
xref: delta_composition "H(37) C(21) N(5) O(6) S"
xref: username_of_poster "MCole18"
xref: group_of_poster ""
xref: date_time_posted "2007-12-12 15:23:23"
xref: date_time_modified "2010-12-03 16:05:51"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C-term"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_1_misc_notes "hydrazide reacts at any activated carboxyl group"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:821
name: Cy3b-maleimide
def: "Fluorescent dye that labels cysteines." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=821]
synonym: "Cy3b meleimide reacted with Cysteine" []
xref: record_id "821"
xref: delta_mono_mass "796.238984"
xref: delta_avge_mass "796.8086"
xref: delta_composition "H(39) C(39) N(4) O(9) F(3) S"
xref: username_of_poster "kfinan"
xref: group_of_poster ""
xref: date_time_posted "2008-02-01 16:03:09"
xref: date_time_modified "2008-02-15 14:09:55"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:822
name: Gly-loss+Amide
def: "Enzymatic glycine removal leaving an amidated C-terminus." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=822]
synonym: "Amidation requires presence of glycine at peptide terminus" []
xref: record_id "822"
xref: delta_mono_mass "-58.005479"
xref: delta_avge_mass "-58.0361"
xref: delta_composition "H(-2) C(-2) O(-2)"
xref: username_of_poster "timothyr"
xref: group_of_poster ""
xref: date_time_posted "2008-02-06 09:33:39"
xref: date_time_modified "2010-07-14 23:15:49"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "G"
xref: spec_1_position "Any C-term"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:824
name: BMOE
def: "Addition of BMOE crosslinker." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=824]
xref: record_id "824"
xref: delta_mono_mass "220.048407"
xref: delta_avge_mass "220.1815"
xref: delta_composition "H(8) C(10) N(2) O(4)"
xref: username_of_poster "Larsenmarsen"
xref: group_of_poster ""
xref: date_time_posted "2008-02-13 15:28:55"
xref: date_time_modified "2008-03-05 16:47:02"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:825
name: DFDNB
def: "Addition of DFDNB crosslinker." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=825]
xref: record_id "825"
xref: delta_mono_mass "203.998263"
xref: delta_avge_mass "204.0879"
xref: delta_composition "H(2) C(6) N(2) O(4) F(2)"
xref: username_of_poster "Larsenmarsen"
xref: group_of_poster ""
xref: date_time_posted "2008-02-13 15:35:40"
xref: date_time_modified "2008-03-05 16:48:47"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "R"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Q"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "N"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:827
name: TMPP-Ac
def: "Tris(2,4,6-trimethoxyphenyl)phosphonium acetic acid N-hydroxysuccinimide ester derivative." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=827]
comment: The formula has been reduced from H(34) to H(33) on 13 May 2009 so as to give correct observed m/z values. The charge on the TMPP means that ions have one less proton than would be expected.
xref: record_id "827"
xref: delta_mono_mass "572.181134"
xref: delta_avge_mass "572.5401"
xref: delta_composition "H(33) C(29) O(10) P"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2008-02-20 14:12:31"
xref: date_time_modified "2009-05-13 18:21:27"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N-term"
xref: spec_1_position "Any N-term"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:830
name: Dihydroxyimidazolidine
def: "Dihydroxy methylglyoxal adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=830]
xref: record_id "830"
xref: delta_mono_mass "72.021129"
xref: delta_avge_mass "72.0627"
xref: delta_composition "H(4) C(3) O(2)"
xref: username_of_poster "kimzey"
xref: group_of_poster ""
xref: date_time_posted "2008-03-04 00:00:29"
xref: date_time_modified "2008-05-22 00:32:41"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Multiple"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:834
name: Label:2H(4)+Acetyl
def: "Acetyl 4,4,5,5-D4 Lysine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=834]
comment: For SILAC experiments, + PTM.
synonym: "Acetyl_K4" []
xref: record_id "834"
xref: delta_mono_mass "46.035672"
xref: delta_avge_mass "46.0613"
xref: delta_composition "H(-2) 2H(4) C(2) O"
xref: username_of_poster "Raghothama"
xref: group_of_poster ""
xref: date_time_posted "2008-03-24 17:25:15"
xref: date_time_modified "2008-04-02 10:17:08"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_1_misc_notes "Both isotopiclabel and post translational mod"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:835
name: Label:13C(6)+Acetyl
def: "Acetyl 13C(6) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, PMID:12716131, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=835]
xref: record_id "835"
xref: delta_mono_mass "48.030694"
xref: delta_avge_mass "47.9926"
xref: delta_composition "H(2) C(-4) 13C(6) O"
xref: username_of_poster "Raghothama"
xref: group_of_poster ""
xref: date_time_posted "2008-03-24 17:33:44"
xref: date_time_modified "2008-04-02 10:14:57"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_1_misc_notes "SILAC and PTM"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:836
name: Label:13C(6)15N(2)+Acetyl
def: "Acetyl_13C(6) 15N(2) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, PMID:12716131, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=836]
synonym: "Acetyl_heavy lysine" []
xref: record_id "836"
xref: delta_mono_mass "50.024764"
xref: delta_avge_mass "49.9794"
xref: delta_composition "H(2) C(-4) 13C(6) N(-2) 15N(2) O"
xref: username_of_poster "Raghothama"
xref: group_of_poster ""
xref: date_time_posted "2008-03-24 17:35:52"
xref: date_time_modified "2008-04-02 10:13:59"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_1_misc_notes "Used in SILAC experiment"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:837
name: Arg->Npo
def: "Arginine replacement by Nitropyrimidyl ornithine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=837]
xref: record_id "837"
xref: delta_mono_mass "80.985078"
xref: delta_avge_mass "81.0297"
xref: delta_composition "H(-1) C(3) N O(2)"
xref: username_of_poster "Kramerh"
xref: group_of_poster ""
xref: date_time_posted "2008-04-10 15:35:22"
xref: date_time_modified "2008-04-21 18:30:45"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:846
name: EQIGG
def: "Sumo mutant Smt3-WT tail following trypsin digestion." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=846]
synonym: "Sumoylation" []
xref: record_id "846"
xref: delta_mono_mass "484.228162"
xref: delta_avge_mass "484.5035"
xref: delta_composition "H(32) C(20) N(6) O(8)"
xref: username_of_poster "Magnojunqueira"
xref: group_of_poster ""
xref: date_time_posted "2008-05-13 16:56:23"
xref: date_time_modified "2008-05-17 18:58:13"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:848
name: Arg2PG
def: "Adduct of phenylglyoxal with Arg." [PMID:11945751, PMID:11698400, PMID:5723461, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=848]
xref: record_id "848"
xref: delta_mono_mass "266.057909"
xref: delta_avge_mass "266.2482"
xref: delta_composition "H(10) C(16) O(4)"
xref: username_of_poster "Kramerh"
xref: group_of_poster ""
xref: date_time_posted "2008-05-16 11:07:51"
xref: date_time_modified "2008-11-21 18:13:56"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_1_misc_notes "The reaction product of Arg with phenylglyoxal has been shown to be a 2:1 adduct"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:849
name: cGMP
def: "S-guanylation." [PMID:17906641, PMID:15063129, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=849]
comment: Protein which is posttranslationally modified by the attachment of cGMP on the sulfur atom of Cys or hydroxyl group of Ser residues.
xref: record_id "849"
xref: delta_mono_mass "344.039610"
xref: delta_avge_mass "344.1974"
xref: delta_composition "H(11) C(10) N(5) O(7) P"
xref: username_of_poster "atsushiirie"
xref: group_of_poster ""
xref: date_time_posted "2008-06-21 09:02:53"
xref: date_time_modified "2009-05-24 20:01:17"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "S"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:851
name: cGMP+RMP-loss
def: "S-guanylation-2." [PMID:17906641, PMID:15063129, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=851]
comment: Protein which is posttranslationally modified by the attachment of cGMP that has lost ribose 3\',5\'-cyclic monophosphate moiety on the sulfur atom of Cys or hydroxyl group of Ser.
xref: record_id "851"
xref: delta_mono_mass "150.041585"
xref: delta_avge_mass "150.1182"
xref: delta_composition "H(4) C(5) N(5) O"
xref: username_of_poster "atsushiirie"
xref: group_of_poster ""
xref: date_time_posted "2008-06-21 09:06:56"
xref: date_time_modified "2009-05-24 20:03:08"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "S"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:853
name: Label:2H(4)+GlyGly
def: "Ubiquitination 2H4 lysine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=853]
xref: record_id "853"
xref: delta_mono_mass "118.068034"
xref: delta_avge_mass "118.1273"
xref: delta_composition "H(2) 2H(4) C(4) N(2) O(2)"
xref: username_of_poster "Raghothama"
xref: group_of_poster ""
xref: date_time_posted "2008-06-27 14:28:36"
xref: date_time_modified "2008-08-13 20:29:26"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:854
name: Label:13C(8)15N(2)
def: "13C(8) 15N(2) Silac label." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=854]
xref: record_id "854"
xref: delta_mono_mass "10.020909"
xref: delta_avge_mass "9.9281"
xref: delta_composition "C(-8) 13C(8) N(-2) 15N(2)"
xref: username_of_poster "nedamoc"
xref: group_of_poster ""
xref: date_time_posted "2008-06-30 20:11:08"
xref: date_time_modified "2008-07-04 19:07:25"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:859
name: MG-H1
def: "Methylglyoxal-derived hydroimidazolone." [PMID:15377717, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=859]
xref: record_id "859"
xref: delta_mono_mass "54.010565"
xref: delta_avge_mass "54.0474"
xref: delta_composition "H(2) C(3) O"
xref: username_of_poster "AndrewW"
xref: group_of_poster ""
xref: date_time_posted "2008-07-24 14:41:07"
xref: date_time_modified "2008-07-31 17:14:35"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:860
name: G-H1
def: "Glyoxal-derived hydroimiadazolone." [PMID:17143934, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=860]
xref: record_id "860"
xref: delta_mono_mass "39.994915"
xref: delta_avge_mass "40.0208"
xref: delta_composition "C(2) O"
xref: username_of_poster "AndrewW"
xref: group_of_poster ""
xref: date_time_posted "2008-07-24 14:44:11"
xref: date_time_modified "2008-07-31 17:16:39"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:861
name: ZGB
def: "NHS ester linked Green Fluorescent Bodipy Dye." [URL:http\://www.zdye.com/, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=861]
xref: record_id "861"
xref: delta_mono_mass "758.380841"
xref: delta_avge_mass "758.7261"
xref: delta_composition "H(53) B C(37) N(6) O(6) F(2) S"
xref: username_of_poster "JBowden"
xref: group_of_poster ""
xref: date_time_posted "2008-07-30 14:51:06"
xref: date_time_modified "2008-09-22 21:42:19"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Other"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:862
name: Label:13C(1)2H(3)
def: "SILAC." [URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=862]
xref: record_id "862"
xref: delta_mono_mass "4.022185"
xref: delta_avge_mass "4.0111"
xref: delta_composition "H(-3) 2H(3) C(-1) 13C"
xref: username_of_poster "msalek"
xref: group_of_poster ""
xref: date_time_posted "2008-08-11 13:43:25"
xref: date_time_modified "2008-08-14 18:16:30"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "M"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_1_misc_notes "Isotopic labeled methionine SILAC"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:864
name: Label:13C(6)15N(2)+GlyGly
def: "13C(6) 15N(2) Lysine glygly." [PMID:12716131, URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=864]
synonym: "heavy glygly lysine" []
xref: record_id "864"
xref: delta_mono_mass "122.057126"
xref: delta_avge_mass "122.0454"
xref: delta_composition "H(6) C(-2) 13C(6) 15N(2) O(2)"
xref: username_of_poster "Raghothama"
xref: group_of_poster ""
xref: date_time_posted "2008-08-13 21:56:52"
xref: date_time_modified "2008-08-14 18:22:40"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_1_misc_notes "Used in SILAC PTM (glygly) experiment"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:866
name: ICPL:13C(6)2H(4)
def: "Bruker Daltonics SERVA-ICPL(TM) quantification chemistry, +10 Da form." [URL:http\://www.bdal.de/life-science-tools/care-consumables-more/icpl-kit.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=866]
comment: Attention: As the digest is typically applied AFTER ICPL labeling, only ProteinN-term labeling and Lys-specific labeling is applied.
synonym: "ICPL_10" []
xref: record_id "866"
xref: delta_mono_mass "115.066700"
xref: delta_avge_mass "115.0747"
xref: delta_composition "H(-1) 2H(4) 13C(6) N O"
xref: username_of_poster "suckau"
xref: group_of_poster ""
xref: date_time_posted "2008-09-03 15:17:21"
xref: date_time_modified "2008-09-12 11:59:23"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "0"
xref: spec_2_site "N-term"
xref: spec_2_position "Protein N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_2_misc_notes "Use when labelling pre-digest"
xref: spec_3_group "3"
xref: spec_3_hidden "0"
xref: spec_3_site "N-term"
xref: spec_3_position "Any N-term"
xref: spec_3_classification "Isotopic label"
xref: spec_3_misc_notes "Use when labelling post-digest"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:876
name: QEQTGG
def: "SUMOylation by SUMO-1." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=876]
synonym: "GlnGluGlnThrGlyGly" []
xref: record_id "876"
xref: delta_mono_mass "600.250354"
xref: delta_avge_mass "600.5789"
xref: delta_composition "H(36) C(23) N(8) O(11)"
xref: username_of_poster "oosula"
xref: group_of_poster ""
xref: date_time_posted "2008-09-09 17:02:45"
xref: date_time_modified "2011-11-25 13:05:17"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
xref: spec_1_misc_notes "This peptide is generated from a trypsin/chymotrypsin dual digest."
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:877
name: QQQTGG
def: "SUMOylation by SUMO-2/3." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=877]
synonym: "GlnGlnGlnThrGlyGly" []
xref: record_id "877"
xref: delta_mono_mass "599.266339"
xref: delta_avge_mass "599.5942"
xref: delta_composition "H(37) C(23) N(9) O(10)"
xref: username_of_poster "oosula"
xref: group_of_poster ""
xref: date_time_posted "2008-09-09 17:09:04"
xref: date_time_modified "2008-09-19 19:06:46"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
xref: spec_1_misc_notes "This peptide is generated from a trypsin/chymotrypsin dual digest"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:878
name: Bodipy
def: "Bodipy modifications onto cysteine." [URL:http\://probes.invitrogen.com/handbook/sections/0104.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=878]
synonym: "Which one?" []
xref: record_id "878"
xref: delta_mono_mass "414.167478"
xref: delta_avge_mass "414.2135"
xref: delta_composition "H(21) B C(20) N(4) O(3) F(2)"
xref: username_of_poster "anikolakakis"
xref: group_of_poster ""
xref: date_time_posted "2008-09-10 20:24:53"
xref: date_time_modified "2008-09-12 18:30:57"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:884
name: Biotin:Thermo-21325
def: "Was ChromoBiotin." [URL:http\://www.piercenet.com/Products/Browse.cfm?fldID=44B1F9DF-B306-4278-B292-6CDB5B3B9D53, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=884]
synonym: "EZ-Link NHS-Chromogenic Biotin" []
xref: record_id "884"
xref: delta_mono_mass "695.310118"
xref: delta_avge_mass "695.8288"
xref: delta_composition "H(45) C(34) N(7) O(7) S"
xref: username_of_poster "chens002"
xref: group_of_poster ""
xref: date_time_posted "2008-10-20 13:26:20"
xref: date_time_modified "2010-12-03 16:04:54"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:885
name: Label:13C(1)2H(3)+Oxidation
def: "Oxidised methionine 13C(1)2H(3) SILAC label." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=885]
xref: record_id "885"
xref: delta_mono_mass "20.017100"
xref: delta_avge_mass "20.0105"
xref: delta_composition "H(-3) 2H(3) C(-1) 13C O"
xref: username_of_poster "BThomas"
xref: group_of_poster ""
xref: date_time_posted "2008-10-24 09:47:20"
xref: date_time_modified "2009-09-25 13:15:07"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "M"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Multiple"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:886
name: HydroxymethylOP
def: "2-ammonio-6-[4-(hydroxymethyl)-3-oxidopyridinium-1-yl]- hexanoate." [PMID:12595094, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=886]
xref: record_id "886"
xref: delta_mono_mass "108.021129"
xref: delta_avge_mass "108.0948"
xref: delta_composition "H(4) C(6) O(2)"
xref: username_of_poster "AndrewW"
xref: group_of_poster ""
xref: date_time_posted "2008-11-03 14:35:36"
xref: date_time_modified "2008-11-09 17:49:00"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
xref: spec_1_misc_notes "Advanced Glycation Endproduct"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:887
name: MDCC
def: "Covalent linkage of maleimidyl coumarin probe (Molecular Probes D-10253)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=887]
comment: MDCC is used extensively as a fluorescent probe to report changes in protein conformation.
synonym: "CAS 156571-46-9 7-diethylamino-3-((((2-maleimidyl)ethyl)amino)carbonyl)coumarin" []
xref: record_id "887"
xref: delta_mono_mass "383.148121"
xref: delta_avge_mass "383.3978"
xref: delta_composition "H(21) C(20) N(3) O(5)"
xref: username_of_poster "shartson"
xref: group_of_poster ""
xref: date_time_posted "2008-12-03 16:20:46"
xref: date_time_modified "2008-12-05 09:32:22"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_1_misc_notes "Due to the mechanism of maleimidyl modification of Cys, the molecular weight of MDCC equals the mass shift created upon crossllinking (no chemical leaving group). During MS/MS, MDCC can reasonably be predicted to fragment readily and at various positions."
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:888
name: mTRAQ
def: "MTRAQ light." [URL:http\://www3.appliedbiosystems.com/cms/groups/psm_support/documents/generaldocuments/cms_054141.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=888]
synonym: "Applied Biosystems mTRAQ(TM) reagent" []
xref: record_id "888"
xref: delta_mono_mass "140.094963"
xref: delta_avge_mass "140.1830"
xref: delta_composition "H(12) C(7) N(2) O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2008-12-04 13:50:02"
xref: date_time_modified "2011-11-25 10:30:51"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "0"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_3_group "3"
xref: spec_3_hidden "0"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Isotopic label"
xref: spec_3_misc_notes "Low abundance"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "H"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Isotopic label"
xref: spec_4_misc_notes "Very low abundance"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "S"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Isotopic label"
xref: spec_5_misc_notes "Very low abundance"
xref: spec_6_group "6"
xref: spec_6_hidden "1"
xref: spec_6_site "T"
xref: spec_6_position "Anywhere"
xref: spec_6_classification "Isotopic label"
xref: spec_6_misc_notes "Very low abundance"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:889
name: mTRAQ:13C(3)15N(1)
def: "MTRAQ medium." [URL:http\://www3.appliedbiosystems.com/cms/groups/psm_support/documents/generaldocuments/cms_054141.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=889]
synonym: "mTRAQ medium is identical to iTRAQ4plex 117 Applied Biosystems mTRAQ(TM) reagent" []
xref: record_id "889"
xref: delta_mono_mass "144.102063"
xref: delta_avge_mass "144.1544"
xref: delta_composition "H(12) C(4) 13C(3) N 15N O"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2008-12-05 09:26:02"
xref: date_time_modified "2011-11-25 10:34:05"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "0"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_2_group "2"
xref: spec_2_hidden "0"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Isotopic label"
xref: spec_3_group "3"
xref: spec_3_hidden "0"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Isotopic label"
xref: spec_3_misc_notes "Low abundance"
xref: spec_4_group "4"
xref: spec_4_hidden "1"
xref: spec_4_site "H"
xref: spec_4_position "Anywhere"
xref: spec_4_classification "Isotopic label"
xref: spec_4_misc_notes "Very low abundance"
xref: spec_5_group "5"
xref: spec_5_hidden "1"
xref: spec_5_site "S"
xref: spec_5_position "Anywhere"
xref: spec_5_classification "Isotopic label"
xref: spec_5_misc_notes "Very low abundance"
xref: spec_6_group "6"
xref: spec_6_hidden "1"
xref: spec_6_site "T"
xref: spec_6_position "Anywhere"
xref: spec_6_classification "Isotopic label"
xref: spec_6_misc_notes "Very low abundance"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:890
name: DyLight-maleimide
def: "Thiol-reactive dye for fluorescence labelling of proteins." [URL:http\://www.piercenet.com/files/1964as4.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=890]
xref: record_id "890"
xref: delta_mono_mass "940.199900"
xref: delta_avge_mass "941.0762"
xref: delta_composition "H(48) C(39) N(4) O(15) S(4)"
xref: username_of_poster "anikolakakis"
xref: group_of_poster ""
xref: date_time_posted "2008-12-05 15:23:15"
xref: date_time_modified "2008-12-15 12:17:39"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:891
name: Methyl-PEO12-Maleimide
def: "Methyl-PEO12-Maleimide." [URL:http\://www.piercenet.com/files/1768dh5.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=891]
xref: record_id "891"
xref: delta_mono_mass "710.383719"
xref: delta_avge_mass "710.8073"
xref: delta_composition "H(58) C(32) N(2) O(15)"
xref: username_of_poster "BThomas"
xref: group_of_poster ""
xref: date_time_posted "2008-12-09 11:02:18"
xref: date_time_modified "2008-12-15 12:15:50"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:893
name: CarbamidomethylDTT
def: "Carbamidomethylated DTT modification of cysteine." [PMID:18653769, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=893]
xref: record_id "893"
xref: delta_mono_mass "209.018035"
xref: delta_avge_mass "209.2864"
xref: delta_composition "H(11) C(6) N O(3) S(2)"
xref: username_of_poster "chalkley"
xref: group_of_poster ""
xref: date_time_posted "2009-01-09 01:39:37"
xref: date_time_modified "2009-01-10 19:03:36"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:894
name: CarboxymethylDTT
def: "Carboxymethylated DTT modification of cysteine." [PMID:18653769, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=894]
xref: record_id "894"
xref: delta_mono_mass "210.002050"
xref: delta_avge_mass "210.2712"
xref: delta_composition "H(10) C(6) O(4) S(2)"
xref: username_of_poster "chalkley"
xref: group_of_poster ""
xref: date_time_posted "2009-01-09 01:43:09"
xref: date_time_modified "2009-01-10 19:03:19"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:895
name: Biotin-PEG-PRA
def: "Biotin polyethyleneoxide (n=3) alkyne." [URL:http\://etd.caltech.edu/etd/available/etd-09132005-120123/unrestricted/Chapter2.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=895]
comment: Methionine (C5H11NO2S) is substituted in cell culture by Azidohomoalanine (C4H8N4O2). The azido group reacts with an alkyne group attached to a linker (PEO) with a biotin group at the end (C27H45N5O7S). As a result the side chain of Met (C3H7S) is substitued by C29H49N8O7S.
xref: record_id "895"
xref: delta_mono_mass "578.317646"
xref: delta_avge_mass "578.6611"
xref: delta_composition "H(42) C(26) N(8) O(7)"
xref: username_of_poster "Larsenmarsen"
xref: group_of_poster ""
xref: date_time_posted "2009-01-19 10:54:58"
xref: date_time_modified "2009-02-06 16:50:56"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "M"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:896
name: Met->Aha
def: "Methionine replacement by azido homoalanine." [PMID:16281315, PMID:11752401, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=896]
xref: record_id "896"
xref: delta_mono_mass "-4.986324"
xref: delta_avge_mass "-5.0794"
xref: delta_composition "H(-3) C(-1) N(3) S(-1)"
xref: username_of_poster "Kramerh"
xref: group_of_poster ""
xref: date_time_posted "2009-01-30 14:52:20"
xref: date_time_modified "2009-02-06 16:38:02"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "M"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Non-standard residue"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:897
name: Label:15N(4)
def: "SILAC 15N(4)." [URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=897]
synonym: "Metabolic labeling with ammonium sulfate (15N)" []
xref: record_id "897"
xref: delta_mono_mass "3.988140"
xref: delta_avge_mass "3.9736"
xref: delta_composition "N(-4) 15N(4)"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2009-02-06 15:29:55"
xref: date_time_modified "2011-11-21 14:26:52"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:898
name: pyrophospho
def: "Pyrophosphorylation of Ser/Thr." [PMID:17873058, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=898]
xref: record_id "898"
xref: delta_mono_mass "159.932662"
xref: delta_avge_mass "159.9598"
xref: delta_composition "H(2) O(6) P(2)"
xref: username_of_poster "Kramerh"
xref: group_of_poster ""
xref: date_time_posted "2009-02-23 20:54:00"
xref: date_time_modified "2009-11-11 09:39:17"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_1_neutral_loss_177_mono_mass "176.935402"
xref: spec_1_neutral_loss_177_avge_mass "176.9671"
xref: spec_1_neutral_loss_177_flag "false"
xref: spec_1_neutral_loss_177_composition "H(3) O(7) P(2)"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
xref: spec_2_neutral_loss_177_mono_mass "176.935402"
xref: spec_2_neutral_loss_177_avge_mass "176.9671"
xref: spec_2_neutral_loss_177_flag "false"
xref: spec_2_neutral_loss_177_composition "H(3) O(7) P(2)"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:899
name: Met->Hpg
def: "Methionine replacement by homopropargylglycine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=899]
xref: record_id "899"
xref: delta_mono_mass "-21.987721"
xref: delta_avge_mass "-22.0702"
xref: delta_composition "H(-2) C S(-1)"
xref: username_of_poster "Kramerh"
xref: group_of_poster ""
xref: date_time_posted "2009-02-24 17:11:44"
xref: date_time_modified "2009-03-13 16:00:16"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "M"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Non-standard residue"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:901
name: 4AcAllylGal
def: "2,3,4,6-tetra-O-Acetyl-1-allyl-alpha-D-galactopyranoside modification of cysteine." [PMID:19798718, PMID:18275052, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=901]
xref: record_id "901"
xref: delta_mono_mass "372.142033"
xref: delta_avge_mass "372.3671"
xref: delta_composition "H(24) C(17) O(9)"
xref: username_of_poster "paolo.nanni"
xref: group_of_poster ""
xref: date_time_posted "2009-03-06 16:08:43"
xref: date_time_modified "2010-02-02 14:27:07"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:902
name: DimethylArsino
def: "Reaction with dimethylarsinous (AsIII) acid." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=902]
comment: Protein from animals exposed to organoarsenicals.
xref: record_id "902"
xref: delta_mono_mass "103.960719"
xref: delta_avge_mass "103.9827"
xref: delta_composition "H(5) C(2) As"
xref: username_of_poster "dashford"
xref: group_of_poster ""
xref: date_time_posted "2009-03-09 17:03:27"
xref: date_time_modified "2009-03-13 15:59:22"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:903
name: Lys->CamCys
def: "Lys->Cys substitution and carbamidomethylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=903]
comment: For Brad Strader.
xref: record_id "903"
xref: delta_mono_mass "31.935685"
xref: delta_avge_mass "32.0219"
xref: delta_composition "H(-4) C(-1) O S"
xref: username_of_poster "hooverdm"
xref: group_of_poster ""
xref: date_time_posted "2009-04-17 14:47:30"
xref: date_time_modified "2009-05-01 16:47:52"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Pre-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:904
name: Phe->CamCys
def: "Phe->Cys substitution and carbamidomethylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=904]
comment: For Brad Strader.
xref: record_id "904"
xref: delta_mono_mass "12.962234"
xref: delta_avge_mass "13.0204"
xref: delta_composition "H(-1) C(-4) N O S"
xref: username_of_poster "hooverdm"
xref: group_of_poster ""
xref: date_time_posted "2009-04-17 14:49:02"
xref: date_time_modified "2009-07-13 18:16:29"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "F"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Pre-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:905
name: Leu->MetOx
def: "Leu->Met substitution and sulfoxidation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=905]
comment: For Brad Strader.
xref: record_id "905"
xref: delta_mono_mass "33.951335"
xref: delta_avge_mass "34.0378"
xref: delta_composition "H(-2) C(-1) O S"
xref: username_of_poster "hooverdm"
xref: group_of_poster ""
xref: date_time_posted "2009-04-17 14:50:35"
xref: date_time_modified "2009-05-01 16:47:06"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "L"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Pre-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:906
name: Lys->MetOx
def: "Lys->Met substitution and sulfoxidation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=906]
comment: For Brad Strader.
xref: record_id "906"
xref: delta_mono_mass "18.940436"
xref: delta_avge_mass "19.0232"
xref: delta_composition "H(-3) C(-1) N(-1) O S"
xref: username_of_poster "hooverdm"
xref: group_of_poster ""
xref: date_time_posted "2009-04-17 14:51:35"
xref: date_time_modified "2009-05-01 16:46:28"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Pre-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:907
name: Galactosyl
def: "Galactosyl hydroxylysine." [PMID:743239, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=907]
xref: record_id "907"
xref: delta_mono_mass "178.047738"
xref: delta_avge_mass "178.1400"
xref: delta_composition "O Hex"
xref: username_of_poster "zientek"
xref: group_of_poster ""
xref: date_time_posted "2009-04-21 18:11:24"
xref: date_time_modified "2010-03-02 20:53:08"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "O-linked glycosylation"
xref: spec_1_neutral_loss_163_mono_mass "162.052824"
xref: spec_1_neutral_loss_163_avge_mass "162.1406"
xref: spec_1_neutral_loss_163_flag "false"
xref: spec_1_neutral_loss_163_composition "Hex"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:908
name: SMCC-maleimide
def: "Modified SMCC maleimide with 3-(dimethylamino)-1-propylamine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=908]
xref: record_id "908"
xref: delta_mono_mass "321.205242"
xref: delta_avge_mass "321.4146"
xref: delta_composition "H(27) C(17) N(3) O(3)"
xref: username_of_poster "anikolakakis"
xref: group_of_poster ""
xref: date_time_posted "2009-04-23 19:39:42"
xref: date_time_modified "2009-05-01 16:41:44"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:910
name: Bacillosamine
def: "2,4-diacetamido-2,4,6-trideoxyglucopyranose." [PMID:12186869, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=910]
synonym: "Asn-linked glycan from Gram-negative Bacterium" []
xref: record_id "910"
xref: delta_mono_mass "228.111007"
xref: delta_avge_mass "228.2450"
xref: delta_composition "H(16) C(10) N(2) O(4)"
xref: username_of_poster "rlmoritz"
xref: group_of_poster ""
xref: date_time_posted "2009-06-23 18:27:32"
xref: date_time_modified "2009-06-26 11:12:01"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "N-linked glycosylation"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:911
name: MTSL
def: "Cys modification by (1-oxyl-2,2,5,5-tetramethyl-3-pyrroline-3-methyl)methanesulfonate (MTSL)." [PMID:9335564, PMID:12441112, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=911]
xref: record_id "911"
xref: delta_mono_mass "184.079610"
xref: delta_avge_mass "184.2786"
xref: delta_composition "H(14) C(9) N O S"
xref: username_of_poster "Kramerh"
xref: group_of_poster ""
xref: date_time_posted "2009-06-25 20:19:40"
xref: date_time_modified "2009-06-26 11:13:49"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:912
name: HNE-BAHAH
def: "4-hydroxy-2-nonenal and biotinamidohexanoic acid hydrazide, reduced." [PMID:19054759, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=912]
comment: For Bindu Abraham.
xref: record_id "912"
xref: delta_mono_mass "511.319226"
xref: delta_avge_mass "511.7209"
xref: delta_composition "H(45) C(25) N(5) O(4) S"
xref: username_of_poster "hooverdm"
xref: group_of_poster ""
xref: date_time_posted "2009-07-13 18:23:28"
xref: date_time_modified "2009-07-17 17:49:45"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "H"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "K"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:914
name: Methylmalonylation
def: "Methylmalonylation on Serine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=914]
comment: Structural isomer to succinyl.
xref: record_id "914"
xref: delta_mono_mass "100.016044"
xref: delta_avge_mass "100.0728"
xref: delta_composition "H(4) C(4) O(3)"
xref: username_of_poster "xwei"
xref: group_of_poster ""
xref: date_time_posted "2009-07-15 23:43:13"
xref: date_time_modified "2010-11-24 17:59:18"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:915
name: Ethoxyformyl
def: "Ethoxyformylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=915]
xref: record_id "915"
xref: delta_mono_mass "73.028954"
xref: delta_avge_mass "73.0706"
xref: delta_composition "H(5) C(3) O(2)"
xref: username_of_poster "BThomas"
xref: group_of_poster ""
xref: date_time_posted "2009-07-24 17:00:29"
xref: date_time_modified "2009-07-26 22:05:56"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "H"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:923
name: Label:13C(4)15N(2)+GlyGly
def: "13C(4) 15N(2) Lysine glygly." [PMID:12716131, URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=923]
synonym: "heavy glygly lysine" []
xref: record_id "923"
xref: delta_mono_mass "120.050417"
xref: delta_avge_mass "120.0601"
xref: delta_composition "H(6) 13C(4) 15N(2) O(2)"
xref: username_of_poster "mpcusack"
xref: group_of_poster ""
xref: date_time_posted "2009-09-16 21:04:07"
xref: date_time_modified "2009-10-02 18:13:08"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
xref: spec_1_misc_notes "Used in SILAC PTM (glygly) experiment"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:926
name: ethylamino
def: "Ethyl amino." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=926]
comment: Product of beta elimination of phospho- or glycosylated-Ser with addition of ethylamine.
xref: record_id "926"
xref: delta_mono_mass "27.047285"
xref: delta_avge_mass "27.0684"
xref: delta_composition "H(5) C(2) N O(-1)"
xref: username_of_poster "cbatthya"
xref: group_of_poster ""
xref: date_time_posted "2009-09-17 20:37:18"
xref: date_time_modified "2009-10-02 18:21:10"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:928
name: MercaptoEthanol
def: "2-OH-ethyl thio-Ser." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=928]
comment: Product of beta elimination of phospho- or glycosylated-Ser with addition of beta Mercapto Ethanol.
xref: record_id "928"
xref: delta_mono_mass "60.003371"
xref: delta_avge_mass "60.1182"
xref: delta_composition "H(4) C(2) S"
xref: username_of_poster "cbatthya"
xref: group_of_poster ""
xref: date_time_posted "2009-09-17 20:43:13"
xref: date_time_modified "2009-10-02 18:23:38"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:931
name: EthylAmide
def: "Solvolysis of amide group on Asn or Gln by ethanol." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=931]
xref: record_id "931"
xref: delta_mono_mass "29.039125"
xref: delta_avge_mass "29.0611"
xref: delta_composition "H(5) C(2)"
xref: username_of_poster "BThomas"
xref: group_of_poster ""
xref: date_time_posted "2009-09-22 11:05:21"
xref: date_time_modified "2009-10-02 18:30:37"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "Q"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:932
name: VFQQQTGG
def: "SUMOylation by SUMO-2/3 (formic acid cleavage)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=932]
synonym: "ValPheGlnGlnGlnThrGlyGly" []
xref: record_id "932"
xref: delta_mono_mass "845.403166"
xref: delta_avge_mass "845.8991"
xref: delta_composition "H(55) C(37) N(11) O(12)"
xref: username_of_poster "oosula"
xref: group_of_poster ""
xref: date_time_posted "2009-09-24 16:11:11"
xref: date_time_modified "2010-02-02 18:25:30"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
xref: spec_1_misc_notes "This peptide is generated from a formic acid digest"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:933
name: VIEVYQEQTGG
def: "SUMOylation by SUMO-1 (formic acid cleavage)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=933]
synonym: "ValIleGluValTyrGlnGluGlnThrGlyGly" []
xref: record_id "933"
xref: delta_mono_mass "1203.577168"
xref: delta_avge_mass "1204.2859"
xref: delta_composition "H(81) C(53) N(13) O(19)"
xref: username_of_poster "oosula"
xref: group_of_poster ""
xref: date_time_posted "2009-09-24 16:15:34"
xref: date_time_modified "2009-10-02 18:31:51"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:934
name: AMTzHexNAc2
def: "Photocleavable Biotin + GalNAz on O-GlcNAc." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=934]
xref: record_id "934"
xref: delta_mono_mass "502.202341"
xref: delta_avge_mass "502.4757"
xref: delta_composition "H(30) C(19) N(6) O(10)"
xref: username_of_poster "mskim"
xref: group_of_poster ""
xref: date_time_posted "2009-10-08 18:05:00"
xref: date_time_modified "2010-10-03 13:45:56"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "N"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "S"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "T"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:935
name: Atto495Maleimide
def: "High molecular absorption maleimide label for proteins." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=935]
xref: record_id "935"
xref: delta_mono_mass "474.250515"
xref: delta_avge_mass "474.5747"
xref: delta_composition "H(32) C(27) N(5) O(3)"
xref: username_of_poster "anikolakakis"
xref: group_of_poster ""
xref: date_time_posted "2009-10-14 18:48:56"
xref: date_time_modified "2009-10-16 14:34:17"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:936
name: Chlorination
def: "Chlorination of tyrosine residues." [PMID:14660678, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=936]
xref: record_id "936"
xref: delta_mono_mass "34.968853"
xref: delta_avge_mass "35.4530"
xref: delta_composition "Cl"
xref: username_of_poster "Bryan"
xref: group_of_poster ""
xref: date_time_posted "2009-10-15 17:07:41"
xref: date_time_modified "2009-10-16 14:40:43"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Y"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:937
name: dichlorination
def: "Dichlorination of tyrosine residues." [PMID:11733505, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=937]
xref: record_id "937"
xref: delta_mono_mass "69.937705"
xref: delta_avge_mass "70.9060"
xref: delta_composition "Cl(2)"
xref: username_of_poster "Bryan"
xref: group_of_poster ""
xref: date_time_posted "2009-10-15 17:12:42"
xref: date_time_modified "2009-10-16 14:40:19"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "Y"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:938
name: AROD
def: "Cysteine modifier." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=938]
comment: The electrophilic moiety of the chemical forms a direct bond with the thiol bond of the cysteine. As a result, there are no losses of elements and the final adduct has the monoisotopic mass of the chemical at 820.3360 added to a cysteine at SH side chain.
xref: record_id "938"
xref: delta_mono_mass "820.336015"
xref: delta_avge_mass "820.9790"
xref: delta_composition "H(52) C(35) N(10) O(9) S(2)"
xref: username_of_poster "hbromage"
xref: group_of_poster ""
xref: date_time_posted "2009-10-15 19:27:20"
xref: date_time_modified "2009-10-16 14:41:49"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:939
name: Cys->methylaminoAla
def: "Carbamidomethylated Cys that undergoes beta-elimination and Michael addition of methylamine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=939]
xref: record_id "939"
xref: delta_mono_mass "-2.945522"
xref: delta_avge_mass "-3.0238"
xref: delta_composition "H(3) C N S(-1)"
xref: username_of_poster "cbatthya"
xref: group_of_poster ""
xref: date_time_posted "2009-10-16 13:50:33"
xref: date_time_modified "2009-10-16 14:44:00"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:940
name: Cys->ethylaminoAla
def: "Carbamidomethylated Cys that undergoes beta-elimination and Michael addition of ethylamine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=940]
xref: record_id "940"
xref: delta_mono_mass "11.070128"
xref: delta_avge_mass "11.0028"
xref: delta_composition "H(5) C(2) N S(-1)"
xref: username_of_poster "cbatthya"
xref: group_of_poster ""
xref: date_time_posted "2009-10-16 13:53:46"
xref: date_time_modified "2009-10-16 14:44:21"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:941
name: DNPS
def: "2,4-Dinitrobenzenesulfenyl." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=941]
synonym: "Trp modification with 2,4-Dinitrobenzenesulfenyl" []
xref: record_id "941"
xref: delta_mono_mass "198.981352"
xref: delta_avge_mass "199.1640"
xref: delta_composition "H(3) C(6) N(2) O(4) S"
xref: username_of_poster "odra.pinato"
xref: group_of_poster ""
xref: date_time_posted "2009-10-19 13:08:56"
xref: date_time_modified "2009-10-30 18:23:17"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
xref: spec_1_misc_notes "Fontana A. Biochemistry. vol 7. 980-986 (1968)"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "W"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_2_misc_notes "derivatization of Trp residues using the 2,4-dinitrophenyl-sulfenyl chloride (DNPS-Cl) reagent, that leads to a Trp derivative with the DNPS label attached at 2-position of the indole nucleus."
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:942
name: SulfoGMBS
def: "High molecular absorption label for proteins." [URL:http\://www.piercenet.com/files/1763dh4.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=942]
xref: record_id "942"
xref: delta_mono_mass "458.162391"
xref: delta_avge_mass "458.5306"
xref: delta_composition "H(26) C(22) N(4) O(5) S"
xref: username_of_poster "anikolakakis"
xref: group_of_poster ""
xref: date_time_posted "2009-10-26 19:28:04"
xref: date_time_modified "2009-11-13 17:02:06"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:943
name: DimethylamineGMBS
def: "Modified GMBS X linker for proteins." [URL:http\://www.piercenet.com/files/1763dh4.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=943]
xref: record_id "943"
xref: delta_mono_mass "267.158292"
xref: delta_avge_mass "267.3241"
xref: delta_composition "H(21) C(13) N(3) O(3)"
xref: username_of_poster "anikolakakis"
xref: group_of_poster ""
xref: date_time_posted "2009-11-04 20:26:57"
xref: date_time_modified "2009-11-13 16:38:29"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:944
name: Label:15N(2)2H(9)
def: "SILAC label." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=944]
synonym: "Label:15N(2)2H(9)" []
xref: record_id "944"
xref: delta_mono_mass "11.050561"
xref: delta_avge_mass "11.0423"
xref: delta_composition "H(-9) 2H(9) N(-2) 15N(2)"
xref: username_of_poster "mskim"
xref: group_of_poster ""
xref: date_time_posted "2009-11-25 22:32:49"
xref: date_time_modified "2009-12-07 20:03:50"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Isotopic label"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:946
name: LG-anhydrolactam
def: "Levuglandinyl-lysine anhydrolactam adduct." [PMID:10413514, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=946]
xref: record_id "946"
xref: delta_mono_mass "314.188195"
xref: delta_avge_mass "314.4186"
xref: delta_composition "H(26) C(20) O(3)"
xref: username_of_poster "wridenour"
xref: group_of_poster ""
xref: date_time_posted "2010-01-12 01:08:28"
xref: date_time_modified "2011-06-08 18:01:31"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:947
name: LG-pyrrole
def: "Levuglandinyl-lysine pyrrole adduct." [PMID:10413514, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=947]
xref: record_id "947"
xref: delta_mono_mass "316.203845"
xref: delta_avge_mass "316.4345"
xref: delta_composition "H(28) C(20) O(3)"
xref: username_of_poster "wridenour"
xref: group_of_poster ""
xref: date_time_posted "2010-01-12 01:12:38"
xref: date_time_modified "2011-06-08 18:01:50"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:948
name: LG-anhyropyrrole
def: "Levuglandinyl-lysine anhyropyrrole adduct." [PMID:10413514, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=948]
xref: record_id "948"
xref: delta_mono_mass "298.193280"
xref: delta_avge_mass "298.4192"
xref: delta_composition "H(26) C(20) O(2)"
xref: username_of_poster "wridenour"
xref: group_of_poster ""
xref: date_time_posted "2010-01-12 01:14:46"
xref: date_time_modified "2011-06-08 17:59:35"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "N-term"
xref: spec_2_position "Any N-term"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:949
name: 3-deoxyglucosone
def: "Condensation product of 3-deoxyglucosone." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=949]
xref: record_id "949"
xref: delta_mono_mass "144.042259"
xref: delta_avge_mass "144.1253"
xref: delta_composition "H(8) C(6) O(4)"
xref: username_of_poster "kimzey"
xref: group_of_poster ""
xref: date_time_posted "2010-01-15 18:19:17"
xref: date_time_modified "2010-01-18 13:20:51"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "R"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Multiple"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:950
name: Cation:Li
def: "Replacement of proton by lithium." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=950]
xref: record_id "950"
xref: delta_mono_mass "6.008178"
xref: delta_avge_mass "5.9331"
xref: delta_composition "H(-1) Li"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2010-01-20 12:17:12"
xref: date_time_modified "2010-01-20 12:17:13"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "D"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "E"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "C-term"
xref: spec_2_position "Any C-term"
xref: spec_2_classification "Artefact"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:951
name: Cation:Ca[II]
def: "Replacement of 2 protons by calcium." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=951]
xref: record_id "951"
xref: delta_mono_mass "37.946941"
xref: delta_avge_mass "38.0621"
xref: delta_composition "H(-2) Ca"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2010-01-20 12:20:03"
xref: date_time_modified "2010-01-20 12:36:41"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "E"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "D"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "C-term"
xref: spec_2_position "Any C-term"
xref: spec_2_classification "Artefact"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:952
name: Cation:Fe[II]
def: "Replacement of 2 protons by iron." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=952]
xref: record_id "952"
xref: delta_mono_mass "53.919289"
xref: delta_avge_mass "53.8291"
xref: delta_composition "H(-2) Fe"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2010-01-20 12:21:03"
xref: date_time_modified "2010-01-20 12:21:03"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "D"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "E"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "C-term"
xref: spec_2_position "Any C-term"
xref: spec_2_classification "Artefact"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:953
name: Cation:Ni[II]
def: "Replacement of 2 protons by nickel." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=953]
xref: record_id "953"
xref: delta_mono_mass "55.919696"
xref: delta_avge_mass "56.6775"
xref: delta_composition "H(-2) Ni"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2010-01-20 12:22:52"
xref: date_time_modified "2010-01-20 12:22:52"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "D"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "E"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "C-term"
xref: spec_2_position "Any C-term"
xref: spec_2_classification "Artefact"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:954
name: Cation:Zn[II]
def: "Replacement of 2 protons by zinc." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=954]
xref: record_id "954"
xref: delta_mono_mass "61.913495"
xref: delta_avge_mass "63.3931"
xref: delta_composition "H(-2) Zn"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2010-01-20 12:23:59"
xref: date_time_modified "2010-01-20 12:24:16"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "E"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "D"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "C-term"
xref: spec_2_position "Any C-term"
xref: spec_2_classification "Artefact"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:955
name: Cation:Ag
def: "Replacement of proton by silver." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=955]
xref: record_id "955"
xref: delta_mono_mass "105.897267"
xref: delta_avge_mass "106.8603"
xref: delta_composition "H(-1) Ag"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2010-01-20 12:30:59"
xref: date_time_modified "2010-01-20 12:30:59"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "D"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "E"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "C-term"
xref: spec_2_position "Any C-term"
xref: spec_2_classification "Artefact"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:956
name: Cation:Mg[II]
def: "Replacement of 2 protons by magnesium." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=956]
xref: record_id "956"
xref: delta_mono_mass "21.969392"
xref: delta_avge_mass "22.2891"
xref: delta_composition "H(-2) Mg"
xref: username_of_poster "unimod"
xref: group_of_poster ""
xref: date_time_posted "2010-01-20 12:36:18"
xref: date_time_modified "2010-01-20 12:36:18"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "D"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "E"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Artefact"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "C-term"
xref: spec_2_position "Any C-term"
xref: spec_2_classification "Artefact"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:957
name: 2-succinyl
def: "S-(2-succinyl) cysteine." [PMID:18448829, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=957]
xref: record_id "957"
xref: delta_mono_mass "116.010959"
xref: delta_avge_mass "116.0722"
xref: delta_composition "H(4) C(4) O(4)"
xref: username_of_poster "BThomas"
xref: group_of_poster ""
xref: date_time_posted "2010-01-26 09:57:53"
xref: date_time_modified "2010-10-15 15:51:20"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:958
name: Propargylamine
def: "Propargylamine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=958]
xref: record_id "958"
xref: delta_mono_mass "37.031634"
xref: delta_avge_mass "37.0632"
xref: delta_composition "H(3) C(3) N O(-1)"
xref: username_of_poster "ywswansea"
xref: group_of_poster ""
xref: date_time_posted "2010-01-26 14:37:33"
xref: date_time_modified "2010-02-01 09:26:28"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C-term"
xref: spec_1_position "Any C-term"
xref: spec_1_classification "Chemical derivative"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "D"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Chemical derivative"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "E"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:959
name: Phosphopropargyl
def: "Phospho-propargylamine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=959]
xref: record_id "959"
xref: delta_mono_mass "116.997965"
xref: delta_avge_mass "117.0431"
xref: delta_composition "H(4) C(3) N O(2) P"
xref: username_of_poster "ywswansea"
xref: group_of_poster ""
xref: date_time_posted "2010-01-26 14:42:08"
xref: date_time_modified "2010-02-01 09:25:52"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "S"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Multiple"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "T"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Multiple"
xref: spec_3_group "3"
xref: spec_3_hidden "1"
xref: spec_3_site "Y"
xref: spec_3_position "Anywhere"
xref: spec_3_classification "Multiple"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:960
name: SUMO2135
def: "SUMOylation by SUMO-1 after tryptic cleavage." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=960]
synonym: "ELGMEEEDVIEVYQEQTGG" []
xref: record_id "960"
xref: delta_mono_mass "2135.920496"
xref: delta_avge_mass "2137.2343"
xref: delta_composition "H(137) C(90) N(21) O(37) S"
xref: username_of_poster "oosula"
xref: group_of_poster ""
xref: date_time_posted "2010-02-02 18:17:15"
xref: date_time_modified "2010-02-14 11:28:47"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:961
name: SUMO3549
def: "SUMOylation by SUMO-2/3 after tryptic cleavage." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=961]
synonym: "FDGQPINETDTPAQLEMEDEDTIDVFQQQTGG" []
xref: record_id "961"
xref: delta_mono_mass "3549.536568"
xref: delta_avge_mass "3551.6672"
xref: delta_composition "H(224) C(150) N(38) O(60) S"
xref: username_of_poster "oosula"
xref: group_of_poster ""
xref: date_time_posted "2010-02-02 18:21:23"
xref: date_time_modified "2010-02-14 11:27:47"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Other"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:967
name: thioacylPA
def: "Membrane protein extraction." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=967]
xref: record_id "967"
xref: delta_mono_mass "159.035399"
xref: delta_avge_mass "159.2062"
xref: delta_composition "H(9) C(6) N O(2) S"
xref: username_of_poster "tmiwamoto"
xref: group_of_poster ""
xref: date_time_posted "2010-02-05 06:00:39"
xref: date_time_modified "2010-04-05 21:31:02"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Chemical derivative"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:971
name: maleimide3
def: "Maleimide-3-saccharide." [PMID:18925771, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=971]
comment: Created for Bindu Abraham 12/22/09.
xref: record_id "971"
xref: delta_mono_mass "969.366232"
xref: delta_avge_mass "969.8975"
xref: delta_composition "H(59) C(37) N(7) O(23)"
xref: username_of_poster "hooverdm"
xref: group_of_poster ""
xref: date_time_posted "2010-02-12 17:23:33"
xref: date_time_modified "2010-04-05 21:30:05"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "K"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "C"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:972
name: maleimide5
def: "Maleimide-5-saccharide." [PMID:18925771, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=972]
comment: Created for Bindu Abraham 12/22/09.
xref: record_id "972"
xref: delta_mono_mass "1293.471879"
xref: delta_avge_mass "1294.1787"
xref: delta_composition "H(79) C(49) N(7) O(33)"
xref: username_of_poster "hooverdm"
xref: group_of_poster ""
xref: date_time_posted "2010-02-12 17:25:52"
xref: date_time_modified "2010-04-05 21:29:47"
xref: approved "0"
xref: spec_1_group "1"
xref: spec_1_hidden "1"
xref: spec_1_site "C"
xref: spec_1_position "Anywhere"
xref: spec_1_classification "Post-translational"
xref: spec_2_group "2"
xref: spec_2_hidden "1"
xref: spec_2_site "K"
xref: spec_2_position "Anywhere"
xref: spec_2_classification "Post-translational"
is_a: UNIMOD:0 ! unimod root node


[Term]
id: UNIMOD:973
name: Puromycin
def: "Puromycin." [PMID:10666460, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=973]
comment: Created for Michael (Brad) Strader 2/12/10.
xref: record_id "973"
xref: delta_mono_mass "453.2